Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3893
Gene name
Locationscaffold_303:8037..8605
Strand+
Gene length (bp)568
Transcript length (bp)420
Coding sequence length (bp)417
Protein length (aa) 139

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05186 Dpy-30 Dpy-30 motif 5.9E-14 90 129

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74861|SDC1_SCHPO Set1 complex component sdc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdc1 PE=3 SV=1 90 133 9.0E-11
sp|Q03323|SDC1_YEAST COMPASS component SDC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDC1 PE=1 SV=1 88 138 1.0E-10
sp|Q9VKQ9|DPY30_DROME Protein dpy-30 homolog OS=Drosophila melanogaster GN=Dpy-30L1 PE=1 SV=1 90 137 2.0E-06
sp|Q10661|DPY30_CAEEL Dosage compensation protein dpy-30 OS=Caenorhabditis elegans GN=dpy-30 PE=2 SV=1 90 128 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3893
MAGLVADPETPLESAQAPATSYAMNDTPTQPTVMTPVKDVVMSDAPPDHATDHSPAPARTGTPAQGSRAASVHPD
AGLVMPSEAVPHGDPTRRYLNSKVTASLLEGMKQLAKDQPQDPLRVLGEFLLQRSKELERTGQA
Coding >Ophio5|3893
ATGGCCGGCCTCGTCGCCGACCCAGAGACGCCACTGGAGTCTGCCCAGGCCCCTGCAACTTCCTACGCTATGAAT
GATACGCCGACGCAGCCGACAGTCATGACCCCCGTCAAGGACGTCGTCATGTCCGACGCGCCGCCCGATCACGCA
ACGGACCACTCGCCCGCACCAGCACGCACCGGCACGCCAGCCCAAGGCTCTCGCGCTGCCTCTGTTCACCCGGAC
GCCGGCTTGGTCATGCCCTCTGAGGCGGTACCGCACGGCGATCCGACCAGACGATACCTCAATTCAAAGGTTACC
GCTTCTTTACTTGAAGGTATGAAGCAGTTGGCAAAGGACCAACCTCAAGACCCATTGCGAGTTCTGGGCGAGTTC
TTACTACAGAGATCTAAGGAATTGGAGAGGACAGGCCAGGCA
Transcript >Ophio5|3893
ATGGCCGGCCTCGTCGCCGACCCAGAGACGCCACTGGAGTCTGCCCAGGCCCCTGCAACTTCCTACGCTATGAAT
GATACGCCGACGCAGCCGACAGTCATGACCCCCGTCAAGGACGTCGTCATGTCCGACGCGCCGCCCGATCACGCA
ACGGACCACTCGCCCGCACCAGCACGCACCGGCACGCCAGCCCAAGGCTCTCGCGCTGCCTCTGTTCACCCGGAC
GCCGGCTTGGTCATGCCCTCTGAGGCGGTACCGCACGGCGATCCGACCAGACGATACCTCAATTCAAAGGTTACC
GCTTCTTTACTTGAAGGTATGAAGCAGTTGGCAAAGGACCAACCTCAAGACCCATTGCGAGTTCTGGGCGAGTTC
TTACTACAGAGATCTAAGGAATTGGAGAGGACAGGCCAGGCATGA
Gene >Ophio5|3893
ATGGCCGGCCTCGTCGCCGACCCAGAGACGCCACTGGAGTCTGCCCAGGCCCCTGCAACTTCCTACGCTATGAAT
GATACGCCGACGCAGCCGACAGTCATGACCCCCGTCAAGGACGTCGTCATGTCCGACGCGCCGCCCGATCACGCA
ACGGTATGGCTCCCCTACTCGCGCGGACATACGGCGGCGCCGCTCCGAGACACCTTGTTCGTTCTGACCGGGCTT
AGGACCACTCGCCCGCACCAGCACGCACCGGCACGCCAGCCCAAGGCTCTCGCGCTGCCTCTGTTCACCCGGACG
CCGGCTTGGTCATGCCCTCTGAGGCGGTACCGCACGGCGATCCGACCAGACGATACCTCAATTCAAAGGTTACCG
CTTCTTTACTTGAAGGTATGAAGCAGTTGGCAAAGGACCAGTGAGCACCCCCGCGACGACTAAATAAGAAGCAAC
ACTTGGCCACTCAACTCACCTACCTGCCCTCAATCGCAGACCTCAAGACCCATTGCGAGTTCTGGGCGAGTTCTT
ACTACAGAGATCTAAGGAATTGGAGAGGACAGGCCAGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail