Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3881
Gene name
Locationscaffold_301:23347..23946
Strand-
Gene length (bp)599
Transcript length (bp)378
Coding sequence length (bp)375
Protein length (aa) 125

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.629 0.3338 0.065 0.2565 0.237 0.0235 0.0509 0.0742 0.0926 0.0585

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2418
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1566
Ophiocordyceps australis map64 (Brazil) OphauB2|4788
Ophiocordyceps camponoti-floridani Ophcf2|03410
Ophiocordyceps camponoti-rufipedis Ophun1|1275
Ophiocordyceps kimflemingae Ophio5|3881 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3433

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3881
MAPSSRSNRSKTSQALRNSARYSTYSMAASSFAPTVQTSDSAQAEIRDIATGLDRMENKALSSQRVALTDEKTDR
LGKLALGAKLERALGRRMSGQDAVMRPRPKSVAISLSLNEKKSAAADKAA
Coding >Ophio5|3881
ATGGCCCCATCATCACGGTCCAACCGGTCAAAGACGTCCCAAGCGCTCAGGAATTCGGCTCGCTACAGCACCTAC
AGCATGGCCGCATCGTCGTTTGCGCCCACGGTCCAGACATCCGATTCCGCCCAGGCCGAGATACGCGACATTGCC
ACCGGCCTCGATCGCATGGAGAATAAGGCTCTCTCGTCCCAGAGGGTGGCCCTGACAGACGAAAAGACGGACAGG
CTCGGAAAGCTCGCTCTCGGCGCCAAGCTCGAGCGCGCCCTCGGCCGTCGCATGAGCGGCCAGGACGCCGTCATG
CGGCCGCGGCCCAAGAGTGTCGCCATCAGCCTGTCGTTAAACGAGAAGAAGTCAGCGGCGGCAGACAAGGCTGCA
Transcript >Ophio5|3881
ATGGCCCCATCATCACGGTCCAACCGGTCAAAGACGTCCCAAGCGCTCAGGAATTCGGCTCGCTACAGCACCTAC
AGCATGGCCGCATCGTCGTTTGCGCCCACGGTCCAGACATCCGATTCCGCCCAGGCCGAGATACGCGACATTGCC
ACCGGCCTCGATCGCATGGAGAATAAGGCTCTCTCGTCCCAGAGGGTGGCCCTGACAGACGAAAAGACGGACAGG
CTCGGAAAGCTCGCTCTCGGCGCCAAGCTCGAGCGCGCCCTCGGCCGTCGCATGAGCGGCCAGGACGCCGTCATG
CGGCCGCGGCCCAAGAGTGTCGCCATCAGCCTGTCGTTAAACGAGAAGAAGTCAGCGGCGGCAGACAAGGCTGCA
TAA
Gene >Ophio5|3881
ATGGCCCCATCAGTACGTCTGTTTTTTCCCTCTTCCTCCCACCCCCCTAACCCTTCTCCACCTCTCATCGTCTTC
TTTCCCTTTTGCTATCCCCAATCCTTTTCTGCCACTGTCTCACCCTTCACCCTTCGCCTTGCTTCATTCTCTCGG
CCAACCATCACAAAATAGTCACGGTCCAACCGGTCAAAGACGTCCCAAGCGGTGTGTGCCCTCTCTCGATTCCCT
CTGCGTCCAAATTCGAGGCTGATTCGTCCCCATCGCCGCAGCTCAGGAATTCGGCTCGCTACAGCACCTACAGCA
TGGCCGCATCGTCGTTTGCGCCCACGGTCCAGACATCCGATTCCGCCCAGGCCGAGATACGCGACATTGCCACCG
GCCTCGATCGCATGGAGAATAAGGCTCTCTCGTCCCAGAGGGTGGCCCTGACAGACGAAAAGACGGACAGGCTCG
GAAAGCTCGCTCTCGGCGCCAAGCTCGAGCGCGCCCTCGGCCGTCGCATGAGCGGCCAGGACGCCGTCATGCGGC
CGCGGCCCAAGAGTGTCGCCATCAGCCTGTCGTTAAACGAGAAGAAGTCAGCGGCGGCAGACAAGGCTGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail