Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|388
Gene name
Locationscaffold_109:41268..42282
Strand-
Gene length (bp)1014
Transcript length (bp)888
Coding sequence length (bp)885
Protein length (aa) 295

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20238 DUF6595 Family of unknown function (DUF6595) 1.3E-32 44 190

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 238 260 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 100.10 55.10 145.10
CcL In ants, during behavior modification 1086.94 175.36 1998.52
CcD In ants, recently dead 54.58 26.39 82.77

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.009502 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|388
MRCSLENTLAVGLALLVTRTSAGHGDTQKSPNNPSTASVTDDTMGPASHLWPPTRKWTADTDNTPPCGSSAAVGF
RTKFPMKGGKVSLVAQDDYYDVQISISYKKNPTENSDFTPLAVARKINDLNPGHTCVDVPDAPTDVVSPGTNATL
QTIYRSNWDKPENQTFYVCSDITFVPAEGFKGRMMCFDATEPGEDDQNPPWIKKVDKKPLGQGPSDKAPAVESVS
SSGSGSKLGSGAIAGISIGALAGSAVVAAIALLLYRRGQQKKRSQRIARMENARQDQGPMEKYSGGDNNA
Coding >Ophio5|388
ATGCGCTGCTCTCTCGAAAACACGCTGGCCGTCGGCCTGGCCCTCTTGGTGACCAGAACTTCCGCCGGCCACGGT
GATACACAGAAGTCACCCAACAACCCGTCGACGGCTTCCGTCACCGATGACACTATGGGACCTGCTTCTCATTTG
TGGCCTCCAACCCGAAAGTGGACGGCCGACACGGACAACACGCCGCCTTGCGGTTCCTCGGCCGCCGTCGGTTTC
CGGACCAAATTTCCCATGAAGGGTGGCAAGGTTTCCCTGGTTGCTCAGGACGACTATTATGATGTCCAGATCAGC
ATCTCGTACAAGAAGAACCCGACTGAGAACAGCGACTTCACGCCTTTGGCCGTCGCCAGGAAGATCAACGACCTC
AACCCGGGCCACACCTGTGTTGACGTTCCCGACGCACCCACAGACGTCGTCTCCCCCGGAACCAACGCCACGCTG
CAAACCATCTACAGAAGCAACTGGGACAAGCCCGAGAACCAGACGTTTTACGTCTGCTCCGACATCACCTTCGTA
CCGGCGGAAGGCTTCAAGGGTAGGATGATGTGCTTCGACGCGACGGAGCCCGGCGAGGATGACCAGAACCCGCCG
TGGATCAAGAAAGTGGACAAGAAGCCGCTGGGCCAAGGCCCGAGCGACAAGGCGCCGGCCGTCGAGTCCGTCTCC
AGCTCCGGATCAGGCTCGAAGCTGGGCAGCGGTGCCATCGCCGGCATCAGCATCGGTGCTCTGGCTGGTTCGGCC
GTGGTGGCAGCCATTGCGCTTCTCCTGTACCGTCGCGGACAGCAGAAGAAGCGCAGCCAGCGCATCGCTCGGATG
GAGAACGCTCGTCAGGATCAGGGACCCATGGAAAAGTACAGCGGCGGTGACAACAACGCG
Transcript >Ophio5|388
ATGCGCTGCTCTCTCGAAAACACGCTGGCCGTCGGCCTGGCCCTCTTGGTGACCAGAACTTCCGCCGGCCACGGT
GATACACAGAAGTCACCCAACAACCCGTCGACGGCTTCCGTCACCGATGACACTATGGGACCTGCTTCTCATTTG
TGGCCTCCAACCCGAAAGTGGACGGCCGACACGGACAACACGCCGCCTTGCGGTTCCTCGGCCGCCGTCGGTTTC
CGGACCAAATTTCCCATGAAGGGTGGCAAGGTTTCCCTGGTTGCTCAGGACGACTATTATGATGTCCAGATCAGC
ATCTCGTACAAGAAGAACCCGACTGAGAACAGCGACTTCACGCCTTTGGCCGTCGCCAGGAAGATCAACGACCTC
AACCCGGGCCACACCTGTGTTGACGTTCCCGACGCACCCACAGACGTCGTCTCCCCCGGAACCAACGCCACGCTG
CAAACCATCTACAGAAGCAACTGGGACAAGCCCGAGAACCAGACGTTTTACGTCTGCTCCGACATCACCTTCGTA
CCGGCGGAAGGCTTCAAGGGTAGGATGATGTGCTTCGACGCGACGGAGCCCGGCGAGGATGACCAGAACCCGCCG
TGGATCAAGAAAGTGGACAAGAAGCCGCTGGGCCAAGGCCCGAGCGACAAGGCGCCGGCCGTCGAGTCCGTCTCC
AGCTCCGGATCAGGCTCGAAGCTGGGCAGCGGTGCCATCGCCGGCATCAGCATCGGTGCTCTGGCTGGTTCGGCC
GTGGTGGCAGCCATTGCGCTTCTCCTGTACCGTCGCGGACAGCAGAAGAAGCGCAGCCAGCGCATCGCTCGGATG
GAGAACGCTCGTCAGGATCAGGGACCCATGGAAAAGTACAGCGGCGGTGACAACAACGCGTAG
Gene >Ophio5|388
ATGCGCTGCTCTCTCGAAAACACGCTGGCCGTCGGCCTGGCCCTCTTGGTGACCAGAACTTCCGCCGGCCACGGT
GATACACAGAAGTCACCCAACAACCCGTCGACGGCTTCCGTCACCGATGACACTATGGGACCTGCTTCTCATTTG
TGGCCTCCAACCCGAAAGTGGACGGCCGACACGGACAACACGCCGCCTTGCGGTTCCTCGGCCGCCGTCGGTTTC
CGGACCAAATTTCCCATGAGTGAGCCTGGCCCTTGGGCTTCGGCTTTTAAAAAAACAATAAGGGATTGCTGACGT
TGATAACCGCCGATTAAGAGGGTGGCAAGGTTTCCCTGGTTGCTCAGGACGACTATTATGATGTCCAGATCAGCA
TCTCGTACAAGAAGAGTCTGTAACCTGTTGTTCGGAACCGGCTTTTCCCCGATGCTAACATCAACAGACCCGACT
GAGAACAGCGACTTCACGCCTTTGGCCGTCGCCAGGAAGATCAACGACCTCAACCCGGGCCACACCTGTGTTGAC
GTTCCCGACGCACCCACAGACGTCGTCTCCCCCGGAACCAACGCCACGCTGCAAACCATCTACAGAAGCAACTGG
GACAAGCCCGAGAACCAGACGTTTTACGTCTGCTCCGACATCACCTTCGTACCGGCGGAAGGCTTCAAGGGTAGG
ATGATGTGCTTCGACGCGACGGAGCCCGGCGAGGATGACCAGAACCCGCCGTGGATCAAGAAAGTGGACAAGAAG
CCGCTGGGCCAAGGCCCGAGCGACAAGGCGCCGGCCGTCGAGTCCGTCTCCAGCTCCGGATCAGGCTCGAAGCTG
GGCAGCGGTGCCATCGCCGGCATCAGCATCGGTGCTCTGGCTGGTTCGGCCGTGGTGGCAGCCATTGCGCTTCTC
CTGTACCGTCGCGGACAGCAGAAGAAGCGCAGCCAGCGCATCGCTCGGATGGAGAACGCTCGTCAGGATCAGGGA
CCCATGGAAAAGTACAGCGGCGGTGACAACAACGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail