Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3869
Gene name
Locationscaffold_300:12538..14192
Strand-
Gene length (bp)1654
Transcript length (bp)1467
Coding sequence length (bp)1464
Protein length (aa) 488

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08595 RXT2_N RXT2-like, N-terminal 2.6E-47 36 177

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94355|RTX2_SCHPO Transcriptional regulatory protein rxt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtx2 PE=1 SV=2 8 182 4.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3057 0.916 0.0762 0.0555 0.0824 0.0047 0.0385 0.0168 0.0094 0.0365

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6295
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3946
Ophiocordyceps australis map64 (Brazil) OphauB2|489
Ophiocordyceps camponoti-floridani Ophcf2|01233
Ophiocordyceps kimflemingae Ophio5|3869 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8772

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3869
MASQQILFAETIAGMKKAFKRKAYESDSDSELESYSNRGNKLKKRARFARQGQLAPTQGPSSYKETVEFAGTLRS
IIHRNPPLLDEDGYEIDSDDDDERVEGATLASADINPYANVRLEQILAPLTASTDLPTHPTLSKPFVSKTLTNLV
SQSCELMRRENQSLWRIRHLWTALCGDGTWMPCGLMVEPDDVTLYTEDHVARHLESLARSGHATGAPTSERNGST
PKHGPGGANDGGDAGRLEEVVRRSAEVPMTDAGASHSKQEAIATLKEANGREQTPAEARQKANNGDVSSGEFESK
GVKRPRREGHGADDAAISSQETLHRAEAHERVDARVKDTDPSADATAPPRTGGDKAPSIASEGSSEQQAFIHPIF
SMPTGARPDRNLGLPEHEAEDIRRLLSLFVQKQEEICRGATRLHHGLLRAERLRKDVLHWSKAEAHCGPNRDLSD
GEDWYDRAEWGLTEDLKKGQDEEEEDTATAGKKTRNRR
Coding >Ophio5|3869
ATGGCGTCGCAGCAGATTCTTTTCGCCGAGACGATAGCCGGCATGAAAAAGGCCTTCAAGAGGAAGGCGTATGAG
TCCGACTCGGATTCAGAGTTGGAGAGCTACAGCAACCGCGGGAACAAGCTGAAGAAGCGGGCTCGCTTCGCACGT
CAGGGACAGTTGGCCCCTACACAGGGACCCAGCTCCTACAAGGAGACCGTCGAGTTCGCAGGCACCCTTCGGTCC
ATCATCCATCGCAACCCGCCCCTGCTCGACGAGGACGGCTACGAAATAGACAGCGACGACGACGACGAGCGCGTC
GAGGGGGCGACCCTCGCGTCCGCGGATATCAACCCGTACGCCAATGTCCGACTAGAACAGATACTGGCGCCCCTG
ACCGCCTCGACCGATCTGCCCACCCATCCAACCCTCTCGAAACCATTCGTCTCCAAGACTCTCACCAACCTGGTC
TCGCAGAGCTGCGAGCTGATGCGAAGAGAGAACCAATCCCTATGGCGCATCAGGCACCTTTGGACAGCCCTCTGC
GGCGATGGCACTTGGATGCCGTGCGGCCTCATGGTCGAGCCTGACGACGTGACCCTCTACACGGAAGACCACGTT
GCCCGGCACCTTGAGAGCCTGGCCCGATCGGGTCATGCCACTGGAGCGCCCACGAGCGAGCGGAATGGCAGCACG
CCCAAACACGGCCCCGGCGGCGCAAACGATGGCGGCGATGCAGGACGGCTAGAGGAGGTGGTGCGCCGCAGCGCC
GAGGTGCCAATGACAGACGCAGGCGCCAGCCACTCGAAGCAGGAGGCAATTGCGACGCTGAAAGAAGCCAACGGA
CGAGAACAAACGCCAGCTGAGGCGCGTCAGAAGGCCAACAACGGAGATGTGAGCAGCGGCGAGTTCGAGAGCAAG
GGCGTAAAGAGGCCGAGACGTGAGGGTCACGGCGCGGACGACGCCGCCATCTCGAGCCAGGAGACGCTGCACCGG
GCGGAGGCGCACGAACGTGTGGACGCGAGGGTGAAAGATACCGACCCGTCAGCGGACGCCACCGCGCCACCGAGG
ACGGGCGGCGACAAGGCTCCGTCAATAGCGTCCGAAGGCTCATCGGAGCAGCAAGCCTTCATCCACCCCATCTTC
TCGATGCCAACGGGCGCCAGGCCGGATCGGAACCTCGGCCTCCCGGAGCACGAGGCCGAGGACATCCGGCGGCTG
CTCTCGCTCTTCGTGCAGAAGCAAGAGGAGATATGCCGCGGGGCGACGCGGCTGCACCACGGCCTCTTGCGGGCG
GAGCGGCTGCGCAAGGACGTGCTGCACTGGTCCAAGGCCGAGGCGCATTGCGGTCCCAACAGAGACTTGTCCGAC
GGCGAGGACTGGTACGACCGTGCGGAATGGGGCCTGACGGAGGACCTCAAAAAGGGTCAGGATGAGGAGGAGGAG
GATACGGCCACGGCTGGCAAGAAGACGAGGAACCGCCGG
Transcript >Ophio5|3869
ATGGCGTCGCAGCAGATTCTTTTCGCCGAGACGATAGCCGGCATGAAAAAGGCCTTCAAGAGGAAGGCGTATGAG
TCCGACTCGGATTCAGAGTTGGAGAGCTACAGCAACCGCGGGAACAAGCTGAAGAAGCGGGCTCGCTTCGCACGT
CAGGGACAGTTGGCCCCTACACAGGGACCCAGCTCCTACAAGGAGACCGTCGAGTTCGCAGGCACCCTTCGGTCC
ATCATCCATCGCAACCCGCCCCTGCTCGACGAGGACGGCTACGAAATAGACAGCGACGACGACGACGAGCGCGTC
GAGGGGGCGACCCTCGCGTCCGCGGATATCAACCCGTACGCCAATGTCCGACTAGAACAGATACTGGCGCCCCTG
ACCGCCTCGACCGATCTGCCCACCCATCCAACCCTCTCGAAACCATTCGTCTCCAAGACTCTCACCAACCTGGTC
TCGCAGAGCTGCGAGCTGATGCGAAGAGAGAACCAATCCCTATGGCGCATCAGGCACCTTTGGACAGCCCTCTGC
GGCGATGGCACTTGGATGCCGTGCGGCCTCATGGTCGAGCCTGACGACGTGACCCTCTACACGGAAGACCACGTT
GCCCGGCACCTTGAGAGCCTGGCCCGATCGGGTCATGCCACTGGAGCGCCCACGAGCGAGCGGAATGGCAGCACG
CCCAAACACGGCCCCGGCGGCGCAAACGATGGCGGCGATGCAGGACGGCTAGAGGAGGTGGTGCGCCGCAGCGCC
GAGGTGCCAATGACAGACGCAGGCGCCAGCCACTCGAAGCAGGAGGCAATTGCGACGCTGAAAGAAGCCAACGGA
CGAGAACAAACGCCAGCTGAGGCGCGTCAGAAGGCCAACAACGGAGATGTGAGCAGCGGCGAGTTCGAGAGCAAG
GGCGTAAAGAGGCCGAGACGTGAGGGTCACGGCGCGGACGACGCCGCCATCTCGAGCCAGGAGACGCTGCACCGG
GCGGAGGCGCACGAACGTGTGGACGCGAGGGTGAAAGATACCGACCCGTCAGCGGACGCCACCGCGCCACCGAGG
ACGGGCGGCGACAAGGCTCCGTCAATAGCGTCCGAAGGCTCATCGGAGCAGCAAGCCTTCATCCACCCCATCTTC
TCGATGCCAACGGGCGCCAGGCCGGATCGGAACCTCGGCCTCCCGGAGCACGAGGCCGAGGACATCCGGCGGCTG
CTCTCGCTCTTCGTGCAGAAGCAAGAGGAGATATGCCGCGGGGCGACGCGGCTGCACCACGGCCTCTTGCGGGCG
GAGCGGCTGCGCAAGGACGTGCTGCACTGGTCCAAGGCCGAGGCGCATTGCGGTCCCAACAGAGACTTGTCCGAC
GGCGAGGACTGGTACGACCGTGCGGAATGGGGCCTGACGGAGGACCTCAAAAAGGGTCAGGATGAGGAGGAGGAG
GATACGGCCACGGCTGGCAAGAAGACGAGGAACCGCCGGTAG
Gene >Ophio5|3869
ATGGCGTCGCAGCAGATTCTTTTCGCCGAGACGATAGCCGGCATGAAAAAGGCCTTCAAGAGGAAGGCGTATGGT
GAGACTGTTTGTCGGGCATTCACCCAAAGAAGAGCAGCAGCTGACCTTGGCTTCTCCCCCGGCAGAGTCCGACTC
GGATTCAGAGTTGGAGAGCTACAGCAACCGCGGGAACAAGCTGAAGAAGCGGGCTCGCTTCGCACGTCAGGGACA
GTTGGCCCCTACACAGGGACCCAGCTCCTACAAGGAGGTAGGACCGTTGCACTCGCCTGTCAACTCGTTGCATGG
GCTGACCTCTGTCCAGACCGTCGAGTTCGCAGGCACCCTTCGGTCCATCATCCATCGCAACCCGCCCCTGCTCGA
CGAGGACGGCTACGAAATAGACAGCGACGACGACGACGAGCGCGTCGAGGGGGCGACCCTCGCGTCCGCGGATAT
CAACCCGTACGCCAATGTCCGACTAGAACGTGAGTCGCCGGCTTCGTCCGTCTCGAGCCATGGGCAAAAGTGATT
CTGACAGCATACTTTCGCAGAGATACTGGCGCCCCTGACCGCCTCGACCGATCTGCCCACCCATCCAACCCTCTC
GAAACCATTCGTCTCCAAGACTCTCACCAACCTGGTCTCGCAGAGCTGCGAGCTGATGCGAAGAGAGAACCAATC
CCTATGGCGCATCAGGCACCTTTGGACAGCCCTCTGCGGCGATGGCACTTGGATGCCGTGCGGCCTCATGGTCGA
GCCTGACGACGTGACCCTCTACACGGAAGACCACGTTGCCCGGCACCTTGAGAGCCTGGCCCGATCGGGTCATGC
CACTGGAGCGCCCACGAGCGAGCGGAATGGCAGCACGCCCAAACACGGCCCCGGCGGCGCAAACGATGGCGGCGA
TGCAGGACGGCTAGAGGAGGTGGTGCGCCGCAGCGCCGAGGTGCCAATGACAGACGCAGGCGCCAGCCACTCGAA
GCAGGAGGCAATTGCGACGCTGAAAGAAGCCAACGGACGAGAACAAACGCCAGCTGAGGCGCGTCAGAAGGCCAA
CAACGGAGATGTGAGCAGCGGCGAGTTCGAGAGCAAGGGCGTAAAGAGGCCGAGACGTGAGGGTCACGGCGCGGA
CGACGCCGCCATCTCGAGCCAGGAGACGCTGCACCGGGCGGAGGCGCACGAACGTGTGGACGCGAGGGTGAAAGA
TACCGACCCGTCAGCGGACGCCACCGCGCCACCGAGGACGGGCGGCGACAAGGCTCCGTCAATAGCGTCCGAAGG
CTCATCGGAGCAGCAAGCCTTCATCCACCCCATCTTCTCGATGCCAACGGGCGCCAGGCCGGATCGGAACCTCGG
CCTCCCGGAGCACGAGGCCGAGGACATCCGGCGGCTGCTCTCGCTCTTCGTGCAGAAGCAAGAGGAGATATGCCG
CGGGGCGACGCGGCTGCACCACGGCCTCTTGCGGGCGGAGCGGCTGCGCAAGGACGTGCTGCACTGGTCCAAGGC
CGAGGCGCATTGCGGTCCCAACAGAGACTTGTCCGACGGCGAGGACTGGTACGACCGTGCGGAATGGGGCCTGAC
GGAGGACCTCAAAAAGGGTCAGGATGAGGAGGAGGAGGATACGGCCACGGCTGGCAAGAAGACGAGGAACCGCCG
GTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail