Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3853
Gene name
Locationscaffold_30:48703..49765
Strand-
Gene length (bp)1062
Transcript length (bp)1062
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00459 Inositol_P Inositol monophosphatase family 5.6E-50 12 348

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BCG1|DPNP_EMENI 3'(2'),5'-bisphosphate nucleotidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1769 PE=1 SV=1 6 351 8.0E-157
sp|O94505|DPNP_SCHPO 3'(2'),5'-bisphosphate nucleotidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tol1 PE=3 SV=1 6 345 7.0E-105
sp|P0CY20|HAL21_CANAL 3'(2'),5'-bisphosphate nucleotidase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAL21 PE=3 SV=1 2 348 1.0E-94
sp|Q59XQ1|HAL22_CANAL 3'(2'),5'-bisphosphate nucleotidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAL22 PE=3 SV=2 2 348 2.0E-93
sp|P0CY21|HAL21_CANAW 3'(2'),5'-bisphosphate nucleotidase 1 OS=Candida albicans (strain WO-1) GN=HAL21 PE=3 SV=1 2 348 3.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BCG1|DPNP_EMENI 3'(2'),5'-bisphosphate nucleotidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1769 PE=1 SV=1 6 351 8.0E-157
sp|O94505|DPNP_SCHPO 3'(2'),5'-bisphosphate nucleotidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tol1 PE=3 SV=1 6 345 7.0E-105
sp|P0CY20|HAL21_CANAL 3'(2'),5'-bisphosphate nucleotidase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAL21 PE=3 SV=1 2 348 1.0E-94
sp|Q59XQ1|HAL22_CANAL 3'(2'),5'-bisphosphate nucleotidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAL22 PE=3 SV=2 2 348 2.0E-93
sp|P0CY21|HAL21_CANAW 3'(2'),5'-bisphosphate nucleotidase 1 OS=Candida albicans (strain WO-1) GN=HAL21 PE=3 SV=1 2 348 3.0E-93
sp|Q42546|DPNP1_ARATH SAL1 phosphatase OS=Arabidopsis thaliana GN=SAL1 PE=1 SV=1 37 353 1.0E-80
sp|P32179|MET22_YEAST 3'(2'),5'-bisphosphate nucleotidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET22 PE=1 SV=1 8 349 9.0E-80
sp|Q2QWT4|DPNP_ORYSJ 3'(2'),5'-bisphosphate nucleotidase OS=Oryza sativa subsp. japonica GN=Os12g0183300 PE=2 SV=1 2 349 6.0E-79
sp|P0C5A3|DPNP_ORYSA 3'(2'),5'-bisphosphate nucleotidase OS=Oryza sativa PE=2 SV=1 2 349 6.0E-79
sp|O49623|DPNP2_ARATH SAL2 phosphatase OS=Arabidopsis thaliana GN=SAL2 PE=2 SV=1 6 353 1.0E-69
sp|Q84VY5|DPNP4_ARATH Probable SAL4 phosphatase OS=Arabidopsis thaliana GN=SAL4 PE=2 SV=1 5 347 1.0E-67
sp|Q8GY63|DPNP3_ARATH Probable SAL3 phosphatase OS=Arabidopsis thaliana GN=SAL3 PE=2 SV=1 16 347 2.0E-65
sp|Q55F34|DPNP_DICDI 3'(2'),5'-bisphosphate nucleotidase OS=Dictyostelium discoideum GN=DDB_G0268652 PE=3 SV=1 1 347 2.0E-55
sp|Q38945|DPNPH_ARATH PAP-specific phosphatase HAL2-like OS=Arabidopsis thaliana GN=AHL PE=2 SV=1 1 345 9.0E-53
sp|Q9M0Y6|DPNPM_ARATH Putative PAP-specific phosphatase, mitochondrial OS=Arabidopsis thaliana GN=At4g05090 PE=2 SV=1 6 345 2.0E-34
sp|P44333|SUHB_HAEIN Inositol-1-monophosphatase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=suhB PE=3 SV=1 132 352 2.0E-11
sp|P95189|HISN_MYCTU Histidinol-phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hisN PE=1 SV=2 129 346 6.0E-09
sp|Q2YDR3|IMPA3_DANRE Inositol monophosphatase 3 OS=Danio rerio GN=impad1 PE=2 SV=1 30 343 7.0E-09
sp|Q9KTY5|SUHB_VIBCH Inositol-1-monophosphatase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_0745 PE=3 SV=2 10 332 6.0E-08
sp|Q19420|IMPA1_CAEEL Inositol monophosphatase ttx-7 OS=Caenorhabditis elegans GN=ttx-7 PE=1 SV=3 132 325 3.0E-07
sp|Q87BG1|SUHB_XYLFT Inositol-1-monophosphatase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=suhB PE=3 SV=1 123 313 1.0E-06
sp|Q54U72|IMPA1_DICDI Inositol monophosphatase OS=Dictyostelium discoideum GN=impa1 PE=3 SV=1 132 331 1.0E-06
sp|Q9PAM0|SUHB_XYLFA Inositol-1-monophosphatase OS=Xylella fastidiosa (strain 9a5c) GN=suhB PE=3 SV=1 123 313 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046855 inositol phosphate dephosphorylation Yes
GO:1901616 organic hydroxy compound catabolic process No
GO:0046164 alcohol catabolic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0016311 dephosphorylation No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043647 inositol phosphate metabolic process No
GO:0044238 primary metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0044282 small molecule catabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0006066 alcohol metabolic process No
GO:0019751 polyol metabolic process No
GO:0046174 polyol catabolic process No
GO:0046838 phosphorylated carbohydrate dephosphorylation No
GO:0009056 catabolic process No
GO:0046434 organophosphate catabolic process No
GO:0019637 organophosphate metabolic process No
GO:0071545 inositol phosphate catabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:1901575 organic substance catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3853
MASSPFARELQVAQQAVQRAAMLTARVFGEAAKGTISKDDASPVTIGDFGAQAIITAALRHNFPADDVVAEEEAA
ALRDDARLRDTVWRLVADVKGLGGGGGDDDGAVADADAMLDLLDGGKSQGGPRGRVWTIDPIDGTKGFLRGGQYA
VCLALLVDGDVKVGVLACPNLPIDDDARLTDLDAADASSPRGVLFSALLGRGATSRPLDSSAADPRPIAMRPIRD
LARATFCESVEAAHSAHGDQAAIARRLGITEPSVRIDSQAKYGSIARGAGDIYLRLPVKASYQEKIWDHAAGDLI
VREAGGHVTDIYGKRLDFSAGRTLANNKGVVAAPAAIHPEVLKAVQEVLGIEQ
Coding >Ophio5|3853
ATGGCATCTTCACCTTTTGCGCGCGAGCTGCAAGTCGCGCAGCAAGCGGTGCAGCGGGCGGCCATGCTCACAGCC
CGCGTCTTCGGCGAAGCGGCCAAGGGCACCATCAGCAAGGACGACGCGTCGCCCGTGACGATTGGCGACTTCGGC
GCTCAGGCCATCATCACGGCTGCGCTGCGTCACAACTTCCCCGCCGACGACGTCGTCGCTGAGGAGGAGGCTGCG
GCGTTGCGGGATGATGCCCGTTTGCGGGATACCGTCTGGCGCCTGGTTGCTGATGTCAAGGGCCTTGGTGGTGGT
GGTGGTGATGATGATGGCGCCGTCGCTGATGCTGATGCTATGCTTGACCTTCTCGACGGAGGGAAAAGTCAGGGC
GGGCCTAGAGGTCGCGTCTGGACCATCGACCCCATCGACGGCACAAAGGGTTTCCTCCGGGGCGGTCAGTACGCC
GTCTGTCTCGCCCTGCTCGTCGACGGAGACGTCAAGGTCGGCGTCCTCGCCTGTCCGAACCTGCCCATCGACGAC
GACGCCCGTCTGACCGATCTCGACGCCGCTGATGCCTCCTCCCCCCGCGGAGTTCTCTTCTCCGCCCTTCTCGGC
CGCGGCGCAACGAGCCGGCCGCTAGACTCGAGCGCAGCCGATCCGCGACCCATCGCCATGCGGCCCATTCGCGAC
CTCGCTCGTGCTACTTTTTGCGAGAGCGTCGAGGCTGCCCACTCGGCTCACGGCGACCAGGCTGCCATCGCTCGA
CGCCTCGGCATCACCGAGCCCAGCGTCCGCATCGACAGTCAAGCCAAGTACGGCTCCATCGCCCGTGGCGCGGGC
GACATCTATCTGCGTCTACCCGTCAAGGCCTCCTACCAGGAGAAGATTTGGGACCACGCCGCCGGCGACCTCATC
GTCCGCGAGGCCGGCGGCCACGTCACTGACATCTACGGCAAGCGCCTCGACTTTAGCGCTGGGCGTACCCTCGCC
AACAACAAGGGAGTCGTGGCCGCTCCGGCTGCAATCCACCCAGAGGTCCTGAAGGCGGTGCAGGAGGTGCTCGGC
ATAGAGCAG
Transcript >Ophio5|3853
ATGGCATCTTCACCTTTTGCGCGCGAGCTGCAAGTCGCGCAGCAAGCGGTGCAGCGGGCGGCCATGCTCACAGCC
CGCGTCTTCGGCGAAGCGGCCAAGGGCACCATCAGCAAGGACGACGCGTCGCCCGTGACGATTGGCGACTTCGGC
GCTCAGGCCATCATCACGGCTGCGCTGCGTCACAACTTCCCCGCCGACGACGTCGTCGCTGAGGAGGAGGCTGCG
GCGTTGCGGGATGATGCCCGTTTGCGGGATACCGTCTGGCGCCTGGTTGCTGATGTCAAGGGCCTTGGTGGTGGT
GGTGGTGATGATGATGGCGCCGTCGCTGATGCTGATGCTATGCTTGACCTTCTCGACGGAGGGAAAAGTCAGGGC
GGGCCTAGAGGTCGCGTCTGGACCATCGACCCCATCGACGGCACAAAGGGTTTCCTCCGGGGCGGTCAGTACGCC
GTCTGTCTCGCCCTGCTCGTCGACGGAGACGTCAAGGTCGGCGTCCTCGCCTGTCCGAACCTGCCCATCGACGAC
GACGCCCGTCTGACCGATCTCGACGCCGCTGATGCCTCCTCCCCCCGCGGAGTTCTCTTCTCCGCCCTTCTCGGC
CGCGGCGCAACGAGCCGGCCGCTAGACTCGAGCGCAGCCGATCCGCGACCCATCGCCATGCGGCCCATTCGCGAC
CTCGCTCGTGCTACTTTTTGCGAGAGCGTCGAGGCTGCCCACTCGGCTCACGGCGACCAGGCTGCCATCGCTCGA
CGCCTCGGCATCACCGAGCCCAGCGTCCGCATCGACAGTCAAGCCAAGTACGGCTCCATCGCCCGTGGCGCGGGC
GACATCTATCTGCGTCTACCCGTCAAGGCCTCCTACCAGGAGAAGATTTGGGACCACGCCGCCGGCGACCTCATC
GTCCGCGAGGCCGGCGGCCACGTCACTGACATCTACGGCAAGCGCCTCGACTTTAGCGCTGGGCGTACCCTCGCC
AACAACAAGGGAGTCGTGGCCGCTCCGGCTGCAATCCACCCAGAGGTCCTGAAGGCGGTGCAGGAGGTGCTCGGC
ATAGAGCAGTAG
Gene >Ophio5|3853
ATGGCATCTTCACCTTTTGCGCGCGAGCTGCAAGTCGCGCAGCAAGCGGTGCAGCGGGCGGCCATGCTCACAGCC
CGCGTCTTCGGCGAAGCGGCCAAGGGCACCATCAGCAAGGACGACGCGTCGCCCGTGACGATTGGCGACTTCGGC
GCTCAGGCCATCATCACGGCTGCGCTGCGTCACAACTTCCCCGCCGACGACGTCGTCGCTGAGGAGGAGGCTGCG
GCGTTGCGGGATGATGCCCGTTTGCGGGATACCGTCTGGCGCCTGGTTGCTGATGTCAAGGGCCTTGGTGGTGGT
GGTGGTGATGATGATGGCGCCGTCGCTGATGCTGATGCTATGCTTGACCTTCTCGACGGAGGGAAAAGTCAGGGC
GGGCCTAGAGGTCGCGTCTGGACCATCGACCCCATCGACGGCACAAAGGGTTTCCTCCGGGGCGGTCAGTACGCC
GTCTGTCTCGCCCTGCTCGTCGACGGAGACGTCAAGGTCGGCGTCCTCGCCTGTCCGAACCTGCCCATCGACGAC
GACGCCCGTCTGACCGATCTCGACGCCGCTGATGCCTCCTCCCCCCGCGGAGTTCTCTTCTCCGCCCTTCTCGGC
CGCGGCGCAACGAGCCGGCCGCTAGACTCGAGCGCAGCCGATCCGCGACCCATCGCCATGCGGCCCATTCGCGAC
CTCGCTCGTGCTACTTTTTGCGAGAGCGTCGAGGCTGCCCACTCGGCTCACGGCGACCAGGCTGCCATCGCTCGA
CGCCTCGGCATCACCGAGCCCAGCGTCCGCATCGACAGTCAAGCCAAGTACGGCTCCATCGCCCGTGGCGCGGGC
GACATCTATCTGCGTCTACCCGTCAAGGCCTCCTACCAGGAGAAGATTTGGGACCACGCCGCCGGCGACCTCATC
GTCCGCGAGGCCGGCGGCCACGTCACTGACATCTACGGCAAGCGCCTCGACTTTAGCGCTGGGCGTACCCTCGCC
AACAACAAGGGAGTCGTGGCCGCTCCGGCTGCAATCCACCCAGAGGTCCTGAAGGCGGTGCAGGAGGTGCTCGGC
ATAGAGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail