Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3852
Gene name
Locationscaffold_30:47063..48288
Strand+
Gene length (bp)1225
Transcript length (bp)882
Coding sequence length (bp)879
Protein length (aa) 293

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00347 Ribosomal_L6 Ribosomal protein L6 1.0E-07 219 278

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32904|RM06_YEAST 54S ribosomal protein L6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL6 PE=1 SV=2 127 293 1.0E-40
sp|Q09865|RM06_SCHPO Putative 54S ribosomal protein L6, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl16 PE=3 SV=1 125 291 5.0E-28
sp|Q3K603|RL6_PSEPF 50S ribosomal protein L6 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplF PE=3 SV=1 134 293 6.0E-28
sp|B8GV43|RL6_THISH 50S ribosomal protein L6 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplF PE=3 SV=1 130 291 1.0E-27
sp|A1W323|RL6_ACISJ 50S ribosomal protein L6 OS=Acidovorax sp. (strain JS42) GN=rplF PE=3 SV=1 113 293 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32904|RM06_YEAST 54S ribosomal protein L6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL6 PE=1 SV=2 127 293 1.0E-40
sp|Q09865|RM06_SCHPO Putative 54S ribosomal protein L6, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl16 PE=3 SV=1 125 291 5.0E-28
sp|Q3K603|RL6_PSEPF 50S ribosomal protein L6 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplF PE=3 SV=1 134 293 6.0E-28
sp|B8GV43|RL6_THISH 50S ribosomal protein L6 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplF PE=3 SV=1 130 291 1.0E-27
sp|A1W323|RL6_ACISJ 50S ribosomal protein L6 OS=Acidovorax sp. (strain JS42) GN=rplF PE=3 SV=1 113 293 1.0E-27
sp|B9MBV2|RL6_ACIET 50S ribosomal protein L6 OS=Acidovorax ebreus (strain TPSY) GN=rplF PE=3 SV=1 113 293 1.0E-27
sp|A6W377|RL6_MARMS 50S ribosomal protein L6 OS=Marinomonas sp. (strain MWYL1) GN=rplF PE=3 SV=1 134 293 2.0E-27
sp|A1AVL5|RL6_RUTMC 50S ribosomal protein L6 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rplF PE=3 SV=1 132 291 2.0E-27
sp|C3K2W1|RL6_PSEFS 50S ribosomal protein L6 OS=Pseudomonas fluorescens (strain SBW25) GN=rplF PE=3 SV=1 134 293 2.0E-27
sp|A9BRW6|RL6_DELAS 50S ribosomal protein L6 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rplF PE=3 SV=1 113 293 2.0E-27
sp|Q1IFV1|RL6_PSEE4 50S ribosomal protein L6 OS=Pseudomonas entomophila (strain L48) GN=rplF PE=3 SV=1 134 293 7.0E-27
sp|A1TYL2|RL6_MARHV 50S ribosomal protein L6 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplF PE=3 SV=1 134 293 8.0E-27
sp|Q4K548|RL6_PSEF5 50S ribosomal protein L6 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplF PE=3 SV=1 134 293 9.0E-27
sp|B2FQJ9|RL6_STRMK 50S ribosomal protein L6 OS=Stenotrophomonas maltophilia (strain K279a) GN=rplF PE=3 SV=1 114 291 1.0E-26
sp|B1JAJ7|RL6_PSEPW 50S ribosomal protein L6 OS=Pseudomonas putida (strain W619) GN=rplF PE=3 SV=1 134 293 1.0E-26
sp|Q88QM0|RL6_PSEPK 50S ribosomal protein L6 OS=Pseudomonas putida (strain KT2440) GN=rplF PE=3 SV=1 134 293 1.0E-26
sp|B0KK82|RL6_PSEPG 50S ribosomal protein L6 OS=Pseudomonas putida (strain GB-1) GN=rplF PE=3 SV=1 134 293 1.0E-26
sp|A5VXR2|RL6_PSEP1 50S ribosomal protein L6 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplF PE=3 SV=1 134 293 1.0E-26
sp|A5CXL9|RL6_VESOH 50S ribosomal protein L6 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rplF PE=3 SV=1 132 291 2.0E-26
sp|B4SKX8|RL6_STRM5 50S ribosomal protein L6 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rplF PE=3 SV=1 114 291 2.0E-26
sp|Q3J8S9|RL6_NITOC 50S ribosomal protein L6 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplF PE=3 SV=1 165 293 2.0E-26
sp|Q6F7S7|RL6_ACIAD 50S ribosomal protein L6 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplF PE=3 SV=1 134 293 3.0E-26
sp|B1Y8C2|RL6_LEPCP 50S ribosomal protein L6 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rplF PE=3 SV=1 170 293 3.0E-26
sp|B0VQT3|RL6_ACIBS 50S ribosomal protein L6 OS=Acinetobacter baumannii (strain SDF) GN=rplF PE=3 SV=1 134 293 4.0E-26
sp|Q2YAY2|RL6_NITMU 50S ribosomal protein L6 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rplF PE=3 SV=1 163 293 4.0E-26
sp|Q0ABG0|RL6_ALKEH 50S ribosomal protein L6 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rplF PE=3 SV=1 130 293 5.0E-26
sp|Q7NQG7|RL6_CHRVO 50S ribosomal protein L6 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rplF PE=3 SV=1 156 293 8.0E-26
sp|Q21M43|RL6_SACD2 50S ribosomal protein L6 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rplF PE=3 SV=1 113 293 9.0E-26
sp|A5N4R2|RL6_CLOK5 50S ribosomal protein L6 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rplF PE=3 SV=1 151 288 9.0E-26
sp|B9DYC4|RL6_CLOK1 50S ribosomal protein L6 OS=Clostridium kluyveri (strain NBRC 12016) GN=rplF PE=3 SV=1 151 288 9.0E-26
sp|A4G9S3|RL6_HERAR 50S ribosomal protein L6 OS=Herminiimonas arsenicoxydans GN=rplF PE=3 SV=1 163 293 1.0E-25
sp|Q74L75|RL6_LACJO 50S ribosomal protein L6 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplF PE=3 SV=1 132 291 1.0E-25
sp|A5WCK5|RL6_PSYWF 50S ribosomal protein L6 OS=Psychrobacter sp. (strain PRwf-1) GN=rplF PE=3 SV=1 134 293 1.0E-25
sp|B0V6W0|RL6_ACIBY 50S ribosomal protein L6 OS=Acinetobacter baumannii (strain AYE) GN=rplF PE=3 SV=1 134 293 2.0E-25
sp|A3M969|RL6_ACIBT 50S ribosomal protein L6 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplF PE=3 SV=2 134 293 2.0E-25
sp|B7IA24|RL6_ACIB5 50S ribosomal protein L6 OS=Acinetobacter baumannii (strain AB0057) GN=rplF PE=3 SV=1 134 293 2.0E-25
sp|B7GW17|RL6_ACIB3 50S ribosomal protein L6 OS=Acinetobacter baumannii (strain AB307-0294) GN=rplF PE=3 SV=1 134 293 2.0E-25
sp|Q50303|RL6_MYCPN 50S ribosomal protein L6 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rplF PE=3 SV=1 127 291 2.0E-25
sp|Q9HWF0|RL6_PSEAE 50S ribosomal protein L6 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplF PE=3 SV=1 165 293 2.0E-25
sp|Q02T65|RL6_PSEAB 50S ribosomal protein L6 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplF PE=3 SV=1 165 293 2.0E-25
sp|B7V659|RL6_PSEA8 50S ribosomal protein L6 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplF PE=3 SV=1 165 293 2.0E-25
sp|A6UZK3|RL6_PSEA7 50S ribosomal protein L6 OS=Pseudomonas aeruginosa (strain PA7) GN=rplF PE=3 SV=1 165 293 2.0E-25
sp|Q31IW7|RL6_THICR 50S ribosomal protein L6 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplF PE=3 SV=1 134 293 2.0E-25
sp|Q8PC37|RL6_XANCP 50S ribosomal protein L6 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rplF PE=3 SV=1 127 291 2.0E-25
sp|B0RU67|RL6_XANCB 50S ribosomal protein L6 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rplF PE=3 SV=1 127 291 2.0E-25
sp|Q4URF4|RL6_XANC8 50S ribosomal protein L6 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rplF PE=3 SV=1 127 291 2.0E-25
sp|A4VHP5|RL6_PSEU5 50S ribosomal protein L6 OS=Pseudomonas stutzeri (strain A1501) GN=rplF PE=3 SV=1 165 293 3.0E-25
sp|C5CQ85|RL6_VARPS 50S ribosomal protein L6 OS=Variovorax paradoxus (strain S110) GN=rplF PE=3 SV=1 113 293 3.0E-25
sp|Q605C7|RL6_METCA 50S ribosomal protein L6 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rplF PE=3 SV=1 163 293 4.0E-25
sp|A6T3I9|RL6_JANMA 50S ribosomal protein L6 OS=Janthinobacterium sp. (strain Marseille) GN=rplF PE=3 SV=1 163 293 4.0E-25
sp|Q1R0G0|RL6_CHRSD 50S ribosomal protein L6 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplF PE=3 SV=1 134 293 4.0E-25
sp|Q3SLN4|RL6_THIDA 50S ribosomal protein L6 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplF PE=3 SV=1 166 293 5.0E-25
sp|Q5GWU9|RL6_XANOR 50S ribosomal protein L6 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rplF PE=3 SV=1 127 291 5.0E-25
sp|Q2P000|RL6_XANOM 50S ribosomal protein L6 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rplF PE=3 SV=1 127 291 5.0E-25
sp|Q3BWW8|RL6_XANC5 50S ribosomal protein L6 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rplF PE=3 SV=1 127 291 6.0E-25
sp|O23049|RK6_ARATH 50S ribosomal protein L6, chloroplastic OS=Arabidopsis thaliana GN=RPL6 PE=2 SV=1 130 288 7.0E-25
sp|A1KRI8|RL6_NEIMF 50S ribosomal protein L6 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rplF PE=3 SV=1 159 291 7.0E-25
sp|Q9K1I3|RL6_NEIMB 50S ribosomal protein L6 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rplF PE=1 SV=1 159 291 7.0E-25
sp|A9M3V1|RL6_NEIM0 50S ribosomal protein L6 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rplF PE=3 SV=1 159 291 7.0E-25
sp|Q9JX14|RL6_NEIMA 50S ribosomal protein L6 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rplF PE=3 SV=1 159 291 8.0E-25
sp|Q046B1|RL6_LACGA 50S ribosomal protein L6 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rplF PE=3 SV=1 132 291 8.0E-25
sp|Q5WZJ7|RL6_LEGPL 50S ribosomal protein L6 OS=Legionella pneumophila (strain Lens) GN=rplF PE=3 SV=1 127 291 1.0E-24
sp|Q5ZYM8|RL6_LEGPH 50S ribosomal protein L6 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplF PE=3 SV=1 127 291 1.0E-24
sp|A5IHP9|RL6_LEGPC 50S ribosomal protein L6 OS=Legionella pneumophila (strain Corby) GN=rplF PE=3 SV=1 127 291 1.0E-24
sp|Q5X844|RL6_LEGPA 50S ribosomal protein L6 OS=Legionella pneumophila (strain Paris) GN=rplF PE=3 SV=1 127 291 1.0E-24
sp|Q0AUJ5|RL6_SYNWW 50S ribosomal protein L6 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rplF PE=3 SV=1 113 291 1.0E-24
sp|Q47J88|RL6_DECAR 50S ribosomal protein L6 OS=Dechloromonas aromatica (strain RCB) GN=rplF PE=3 SV=1 170 293 1.0E-24
sp|Q5F5U2|RL6_NEIG1 50S ribosomal protein L6 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rplF PE=3 SV=1 159 291 1.0E-24
sp|B0U0X4|RL6_FRAP2 50S ribosomal protein L6 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplF PE=3 SV=1 149 293 2.0E-24
sp|Q889V6|RL6_PSESM 50S ribosomal protein L6 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplF PE=3 SV=1 134 293 2.0E-24
sp|Q48D51|RL6_PSE14 50S ribosomal protein L6 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplF PE=3 SV=1 127 293 2.0E-24
sp|A1KB12|RL6_AZOSB 50S ribosomal protein L6 OS=Azoarcus sp. (strain BH72) GN=rplF PE=3 SV=1 144 293 2.0E-24
sp|Q0VSI8|RL6_ALCBS 50S ribosomal protein L6 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplF PE=3 SV=1 170 293 2.0E-24
sp|Q04C00|RL6_LACDB 50S ribosomal protein L6 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rplF PE=3 SV=1 132 291 3.0E-24
sp|Q1GBK3|RL6_LACDA 50S ribosomal protein L6 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rplF PE=3 SV=1 132 291 3.0E-24
sp|O52347|RL6_MYCGA 50S ribosomal protein L6 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rplF PE=3 SV=2 127 286 3.0E-24
sp|A4XZ75|RL6_PSEMY 50S ribosomal protein L6 OS=Pseudomonas mendocina (strain ymp) GN=rplF PE=3 SV=1 165 293 3.0E-24
sp|Q38US6|RL6_LACSS 50S ribosomal protein L6 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rplF PE=3 SV=1 168 291 4.0E-24
sp|B1WQS5|RL6_CYAA5 50S ribosomal protein L6 OS=Cyanothece sp. (strain ATCC 51142) GN=rplF PE=3 SV=1 130 291 4.0E-24
sp|Q8EUC8|RL6_MYCPE 50S ribosomal protein L6 OS=Mycoplasma penetrans (strain HF-2) GN=rplF PE=3 SV=1 165 291 4.0E-24
sp|A0T0Y7|RK6_THAPS 50S ribosomal protein L6, chloroplastic OS=Thalassiosira pseudonana GN=rpl6 PE=3 SV=1 132 291 4.0E-24
sp|Q8PNR2|RL6_XANAC 50S ribosomal protein L6 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rplF PE=3 SV=1 124 291 4.0E-24
sp|C5BQ76|RL6_TERTT 50S ribosomal protein L6 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplF PE=3 SV=1 151 293 5.0E-24
sp|B7IHW1|RL6_THEAB 50S ribosomal protein L6 OS=Thermosipho africanus (strain TCF52B) GN=rplF PE=3 SV=1 130 288 5.0E-24
sp|Q2SU42|RL6_BURTA 50S ribosomal protein L6 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rplF PE=3 SV=1 116 293 5.0E-24
sp|A1TJT2|RL6_ACIAC 50S ribosomal protein L6 OS=Acidovorax citrulli (strain AAC00-1) GN=rplF PE=3 SV=1 164 293 5.0E-24
sp|Q3IJK0|RL6_PSEHT 50S ribosomal protein L6 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplF PE=3 SV=1 172 293 7.0E-24
sp|P47412|RL6_MYCGE 50S ribosomal protein L6 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rplF PE=3 SV=1 138 285 8.0E-24
sp|Q5QXW0|RL6_IDILO 50S ribosomal protein L6 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplF PE=3 SV=1 172 293 8.0E-24
sp|A6LLM8|RL6_THEM4 50S ribosomal protein L6 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplF PE=3 SV=1 112 288 8.0E-24
sp|Q4ZMQ9|RL6_PSEU2 50S ribosomal protein L6 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplF PE=3 SV=1 134 293 9.0E-24
sp|C4K7A3|RL6_HAMD5 50S ribosomal protein L6 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplF PE=3 SV=1 172 293 1.0E-23
sp|Q0BNR2|RL6_FRATO 50S ribosomal protein L6 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplF PE=3 SV=1 163 293 1.0E-23
sp|Q2A5F5|RL6_FRATH 50S ribosomal protein L6 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplF PE=3 SV=1 163 293 1.0E-23
sp|A7N9U0|RL6_FRATF 50S ribosomal protein L6 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplF PE=3 SV=1 163 293 1.0E-23
sp|Q0BJ31|RL6_BURCM 50S ribosomal protein L6 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rplF PE=3 SV=1 116 293 1.0E-23
sp|Q2RQX5|RL6_RHORT 50S ribosomal protein L6 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplF PE=3 SV=1 165 291 1.0E-23
sp|A4IZR9|RL6_FRATW 50S ribosomal protein L6 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplF PE=3 SV=1 134 293 1.0E-23
sp|B2SDX0|RL6_FRATM 50S ribosomal protein L6 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplF PE=3 SV=1 163 293 1.0E-23
sp|Q63Q26|RL6_BURPS 50S ribosomal protein L6 OS=Burkholderia pseudomallei (strain K96243) GN=rplF PE=3 SV=1 116 293 1.0E-23
sp|A3NEG4|RL6_BURP6 50S ribosomal protein L6 OS=Burkholderia pseudomallei (strain 668) GN=rplF PE=3 SV=1 116 293 1.0E-23
sp|Q3JMS8|RL6_BURP1 50S ribosomal protein L6 OS=Burkholderia pseudomallei (strain 1710b) GN=rplF PE=3 SV=1 116 293 1.0E-23
sp|A3P098|RL6_BURP0 50S ribosomal protein L6 OS=Burkholderia pseudomallei (strain 1106a) GN=rplF PE=3 SV=1 116 293 1.0E-23
sp|A1V888|RL6_BURMS 50S ribosomal protein L6 OS=Burkholderia mallei (strain SAVP1) GN=rplF PE=3 SV=1 116 293 1.0E-23
sp|Q62GM0|RL6_BURMA 50S ribosomal protein L6 OS=Burkholderia mallei (strain ATCC 23344) GN=rplF PE=3 SV=1 116 293 1.0E-23
sp|A2S7J1|RL6_BURM9 50S ribosomal protein L6 OS=Burkholderia mallei (strain NCTC 10229) GN=rplF PE=3 SV=1 116 293 1.0E-23
sp|A3MRW9|RL6_BURM7 50S ribosomal protein L6 OS=Burkholderia mallei (strain NCTC 10247) GN=rplF PE=3 SV=1 116 293 1.0E-23
sp|A5EXA3|RL6_DICNV 50S ribosomal protein L6 OS=Dichelobacter nodosus (strain VCS1703A) GN=rplF PE=3 SV=1 134 293 2.0E-23
sp|Q5NHV3|RL6_FRATT 50S ribosomal protein L6 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplF PE=3 SV=1 163 293 2.0E-23
sp|Q14JA5|RL6_FRAT1 50S ribosomal protein L6 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplF PE=3 SV=1 163 293 2.0E-23
sp|C1DAT2|RL6_LARHH 50S ribosomal protein L6 OS=Laribacter hongkongensis (strain HLHK9) GN=rplF PE=3 SV=1 137 293 2.0E-23
sp|A1WVA7|RL6_HALHL 50S ribosomal protein L6 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rplF PE=3 SV=1 146 293 2.0E-23
sp|A0Q4J8|RL6_FRATN 50S ribosomal protein L6 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplF PE=3 SV=1 163 293 2.0E-23
sp|Q5P317|RL6_AROAE 50S ribosomal protein L6 OS=Aromatoleum aromaticum (strain EbN1) GN=rplF PE=3 SV=1 168 293 2.0E-23
sp|Q65QX0|RL6_MANSM 50S ribosomal protein L6 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplF PE=3 SV=1 134 293 2.0E-23
sp|A5V5Y7|RL6_SPHWW 50S ribosomal protein L6 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplF PE=3 SV=1 127 278 2.0E-23
sp|Q5NQ50|RL6_ZYMMO 50S ribosomal protein L6 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplF PE=3 SV=1 127 278 2.0E-23
sp|B1YRP4|RL6_BURA4 50S ribosomal protein L6 OS=Burkholderia ambifaria (strain MC40-6) GN=rplF PE=3 SV=1 116 293 2.0E-23
sp|Q0SQF9|RL6_CLOPS 50S ribosomal protein L6 OS=Clostridium perfringens (strain SM101 / Type A) GN=rplF PE=3 SV=1 132 291 3.0E-23
sp|Q8XHT8|RL6_CLOPE 50S ribosomal protein L6 OS=Clostridium perfringens (strain 13 / Type A) GN=rplF PE=3 SV=1 132 291 3.0E-23
sp|Q0TMR1|RL6_CLOP1 50S ribosomal protein L6 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rplF PE=3 SV=1 132 291 3.0E-23
sp|Q1H4M2|RL6_METFK 50S ribosomal protein L6 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rplF PE=3 SV=1 164 293 3.0E-23
sp|B2TIJ0|RL6_CLOBB 50S ribosomal protein L6 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rplF PE=3 SV=1 163 288 3.0E-23
sp|A8MLF5|RL6_ALKOO 50S ribosomal protein L6 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplF PE=3 SV=1 104 291 3.0E-23
sp|Q0K634|RL6_CUPNH 50S ribosomal protein L6 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplF PE=3 SV=1 127 293 3.0E-23
sp|Q839E9|RL6_ENTFA 50S ribosomal protein L6 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplF PE=3 SV=1 163 278 3.0E-23
sp|Q39KF2|RL6_BURL3 50S ribosomal protein L6 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rplF PE=3 SV=1 116 293 4.0E-23
sp|Q6CZY5|RL6_PECAS 50S ribosomal protein L6 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplF PE=3 SV=1 172 293 4.0E-23
sp|B5ELZ4|RL6_ACIF5 50S ribosomal protein L6 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rplF PE=3 SV=1 155 293 4.0E-23
sp|B7J482|RL6_ACIF2 50S ribosomal protein L6 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rplF PE=3 SV=1 155 293 4.0E-23
sp|A9ADK8|RL6_BURM1 50S ribosomal protein L6 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rplF PE=3 SV=1 116 293 4.0E-23
sp|B4RT43|RL6_ALTMD 50S ribosomal protein L6 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rplF PE=3 SV=1 172 293 4.0E-23
sp|Q7VGC9|RL6_HELHP 50S ribosomal protein L6 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rplF PE=3 SV=1 132 291 4.0E-23
sp|B3PK52|RL6_CELJU 50S ribosomal protein L6 OS=Cellvibrio japonicus (strain Ueda107) GN=rplF PE=3 SV=1 134 293 5.0E-23
sp|B3R7F3|RL6_CUPTR 50S ribosomal protein L6 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rplF PE=3 SV=1 127 293 5.0E-23
sp|B4E5D5|RL6_BURCJ 50S ribosomal protein L6 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rplF PE=3 SV=1 116 293 5.0E-23
sp|A0K3P0|RL6_BURCH 50S ribosomal protein L6 OS=Burkholderia cenocepacia (strain HI2424) GN=rplF PE=3 SV=1 116 293 5.0E-23
sp|B1JU37|RL6_BURCC 50S ribosomal protein L6 OS=Burkholderia cenocepacia (strain MC0-3) GN=rplF PE=3 SV=1 116 293 5.0E-23
sp|Q1BRW3|RL6_BURCA 50S ribosomal protein L6 OS=Burkholderia cenocepacia (strain AU 1054) GN=rplF PE=3 SV=1 116 293 5.0E-23
sp|B0UHV4|RL6_METS4 50S ribosomal protein L6 OS=Methylobacterium sp. (strain 4-46) GN=rplF PE=3 SV=1 134 293 5.0E-23
sp|A4JAQ5|RL6_BURVG 50S ribosomal protein L6 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rplF PE=3 SV=1 157 293 5.0E-23
sp|A7HM37|RL6_FERNB 50S ribosomal protein L6 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rplF PE=3 SV=1 130 288 5.0E-23
sp|A8F4S6|RL6_PSELT 50S ribosomal protein L6 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rplF PE=3 SV=1 127 288 6.0E-23
sp|Q15X58|RL6_PSEA6 50S ribosomal protein L6 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplF PE=3 SV=1 172 293 6.0E-23
sp|Q88XX1|RL6_LACPL 50S ribosomal protein L6 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rplF PE=3 SV=1 127 291 6.0E-23
sp|B2JI50|RL6_BURP8 50S ribosomal protein L6 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rplF PE=3 SV=1 164 293 6.0E-23
sp|A6TWG7|RL6_ALKMQ 50S ribosomal protein L6 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rplF PE=3 SV=1 165 291 7.0E-23
sp|Q6YR07|RL6_ONYPE 50S ribosomal protein L6 OS=Onion yellows phytoplasma (strain OY-M) GN=rplF PE=3 SV=1 112 291 7.0E-23
sp|A9H3L8|RL6_GLUDA 50S ribosomal protein L6 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplF PE=3 SV=1 132 293 7.0E-23
sp|A9W4S5|RL6_METEP 50S ribosomal protein L6 OS=Methylobacterium extorquens (strain PA1) GN=rplF PE=3 SV=1 134 278 7.0E-23
sp|B7L0T5|RL6_METC4 50S ribosomal protein L6 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rplF PE=3 SV=1 134 278 7.0E-23
sp|Q3A9T1|RL6_CARHZ 50S ribosomal protein L6 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplF PE=3 SV=1 163 286 7.0E-23
sp|B2UYC5|RL6_CLOBA 50S ribosomal protein L6 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rplF PE=3 SV=1 163 291 8.0E-23
sp|A0L5Y8|RL6_MAGMM 50S ribosomal protein L6 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rplF PE=3 SV=1 132 291 8.0E-23
sp|P49548|RK6_ODOSI 50S ribosomal protein L6, chloroplastic OS=Odontella sinensis GN=rpl6 PE=3 SV=1 132 291 8.0E-23
sp|Q9CL45|RL6_PASMU 50S ribosomal protein L6 OS=Pasteurella multocida (strain Pm70) GN=rplF PE=3 SV=1 172 293 9.0E-23
sp|A0PXW1|RL6_CLONN 50S ribosomal protein L6 OS=Clostridium novyi (strain NT) GN=rplF PE=3 SV=1 151 291 1.0E-22
sp|Q6F1X9|RL6_MESFL 50S ribosomal protein L6 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rplF PE=3 SV=1 165 285 1.0E-22
sp|Q2RFR2|RL6_MOOTA 50S ribosomal protein L6 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplF PE=3 SV=1 127 286 1.0E-22
sp|Q46WF9|RL6_CUPPJ 50S ribosomal protein L6 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rplF PE=3 SV=1 127 293 1.0E-22
sp|B2UQM5|RL6_AKKM8 50S ribosomal protein L6 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rplF PE=3 SV=1 130 291 1.0E-22
sp|Q4G353|RK6_EMIHU 50S ribosomal protein L6, chloroplastic OS=Emiliania huxleyi GN=rpl6 PE=3 SV=1 130 291 1.0E-22
sp|B3QYD9|RL6_CHLT3 50S ribosomal protein L6 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rplF PE=3 SV=1 113 288 1.0E-22
sp|Q2N9C6|RL6_ERYLH 50S ribosomal protein L6 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplF PE=3 SV=1 113 278 1.0E-22
sp|A6VLK3|RL6_ACTSZ 50S ribosomal protein L6 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplF PE=3 SV=1 172 293 1.0E-22
sp|Q1GPB4|RL6_SPHAL 50S ribosomal protein L6 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplF PE=3 SV=1 122 278 1.0E-22
sp|B7VLE2|RL6_VIBTL 50S ribosomal protein L6 OS=Vibrio tasmaniensis (strain LGP32) GN=rplF PE=3 SV=1 172 293 1.0E-22
sp|A7GJ59|RL6_CLOBL 50S ribosomal protein L6 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rplF PE=3 SV=1 151 288 1.0E-22
sp|B2VK81|RL6_ERWT9 50S ribosomal protein L6 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplF PE=3 SV=1 172 293 1.0E-22
sp|Q18CH5|RL6_PEPD6 50S ribosomal protein L6 OS=Peptoclostridium difficile (strain 630) GN=rplF PE=3 SV=1 127 288 1.0E-22
sp|B2T736|RL6_BURPP 50S ribosomal protein L6 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rplF PE=3 SV=1 144 293 1.0E-22
sp|B1IGD9|RL6_CLOBK 50S ribosomal protein L6 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplF PE=3 SV=1 151 291 1.0E-22
sp|C6DG59|RL6_PECCP 50S ribosomal protein L6 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplF PE=3 SV=1 172 293 1.0E-22
sp|A1VJ30|RL6_POLNA 50S ribosomal protein L6 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rplF PE=3 SV=1 112 282 2.0E-22
sp|B1Z778|RL6_METPB 50S ribosomal protein L6 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplF PE=3 SV=1 163 278 2.0E-22
sp|B1KSL0|RL6_CLOBM 50S ribosomal protein L6 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rplF PE=3 SV=1 151 288 2.0E-22
sp|Q1QDH1|RL6_PSYCK 50S ribosomal protein L6 OS=Psychrobacter cryohalolentis (strain K5) GN=rplF PE=3 SV=1 146 291 2.0E-22
sp|B0T2D7|RL6_CAUSK 50S ribosomal protein L6 OS=Caulobacter sp. (strain K31) GN=rplF PE=3 SV=1 130 293 2.0E-22
sp|Q21QN8|RL6_RHOFT 50S ribosomal protein L6 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rplF PE=3 SV=1 163 282 2.0E-22
sp|Q4FUE1|RL6_PSYA2 50S ribosomal protein L6 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplF PE=3 SV=1 146 291 2.0E-22
sp|Q890Q0|RL6_CLOTE 50S ribosomal protein L6 OS=Clostridium tetani (strain Massachusetts / E88) GN=rplF PE=3 SV=1 151 291 2.0E-22
sp|Q2S927|RL6_HAHCH 50S ribosomal protein L6 OS=Hahella chejuensis (strain KCTC 2396) GN=rplF PE=3 SV=1 164 293 2.0E-22
sp|A0ALV3|RL6_LISW6 50S ribosomal protein L6 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplF PE=3 SV=1 132 291 2.0E-22
sp|Q927M2|RL6_LISIN 50S ribosomal protein L6 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplF PE=3 SV=1 132 291 2.0E-22
sp|P02391|RL6_GEOSE 50S ribosomal protein L6 OS=Geobacillus stearothermophilus GN=rplF PE=1 SV=2 132 291 2.0E-22
sp|Q5L408|RL6_GEOKA 50S ribosomal protein L6 OS=Geobacillus kaustophilus (strain HTA426) GN=rplF PE=3 SV=1 132 291 2.0E-22
sp|A2SLE2|RL6_METPP 50S ribosomal protein L6 OS=Methylibium petroleiphilum (strain PM1) GN=rplF PE=3 SV=1 170 293 3.0E-22
sp|Q8Y444|RL6_LISMO 50S ribosomal protein L6 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplF PE=3 SV=1 132 291 3.0E-22
sp|B8DB23|RL6_LISMH 50S ribosomal protein L6 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplF PE=3 SV=1 132 291 3.0E-22
sp|B3WAK3|RL6_LACCB 50S ribosomal protein L6 OS=Lactobacillus casei (strain BL23) GN=rplF PE=3 SV=1 168 291 3.0E-22
sp|Q034Z8|RL6_LACC3 50S ribosomal protein L6 OS=Lactobacillus casei (strain ATCC 334) GN=rplF PE=3 SV=1 168 291 3.0E-22
sp|C1FMT6|RL6_CLOBJ 50S ribosomal protein L6 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rplF PE=3 SV=1 151 291 3.0E-22
sp|A5I7J1|RL6_CLOBH 50S ribosomal protein L6 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rplF PE=3 SV=1 151 291 3.0E-22
sp|A7FZ54|RL6_CLOB1 50S ribosomal protein L6 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rplF PE=3 SV=1 151 291 3.0E-22
sp|B6J248|RL6_COXB2 50S ribosomal protein L6 OS=Coxiella burnetii (strain CbuG_Q212) GN=rplF PE=3 SV=1 170 293 3.0E-22
sp|C3KVN6|RL6_CLOB6 50S ribosomal protein L6 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rplF PE=3 SV=1 151 291 3.0E-22
sp|Q71WG1|RL6_LISMF 50S ribosomal protein L6 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplF PE=3 SV=1 132 291 3.0E-22
sp|C1KZG5|RL6_LISMC 50S ribosomal protein L6 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplF PE=3 SV=1 132 291 3.0E-22
sp|B5XNA8|RL6_KLEP3 50S ribosomal protein L6 OS=Klebsiella pneumoniae (strain 342) GN=rplF PE=3 SV=1 172 293 3.0E-22
sp|B8ISA0|RL6_METNO 50S ribosomal protein L6 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rplF PE=3 SV=1 134 293 3.0E-22
sp|Q1LI52|RL6_CUPMC 50S ribosomal protein L6 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rplF PE=3 SV=1 127 293 4.0E-22
sp|P0AG58|RL6_SHIFL 50S ribosomal protein L6 OS=Shigella flexneri GN=rplF PE=3 SV=2 172 293 4.0E-22
sp|Q0SZZ7|RL6_SHIF8 50S ribosomal protein L6 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|Q32B46|RL6_SHIDS 50S ribosomal protein L6 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|Q31VX1|RL6_SHIBS 50S ribosomal protein L6 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B2U2S3|RL6_SHIB3 50S ribosomal protein L6 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|Q089N9|RL6_SHEFN 50S ribosomal protein L6 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplF PE=3 SV=1 155 293 4.0E-22
sp|Q1R624|RL6_ECOUT 50S ribosomal protein L6 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B1LHB9|RL6_ECOSM 50S ribosomal protein L6 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B6I219|RL6_ECOSE 50S ribosomal protein L6 OS=Escherichia coli (strain SE11) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B7NDS6|RL6_ECOLU 50S ribosomal protein L6 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|P0AG55|RL6_ECOLI 50S ribosomal protein L6 OS=Escherichia coli (strain K12) GN=rplF PE=1 SV=2 172 293 4.0E-22
sp|B1IPZ4|RL6_ECOLC 50S ribosomal protein L6 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|P0AG56|RL6_ECOL6 50S ribosomal protein L6 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplF PE=3 SV=2 172 293 4.0E-22
sp|Q0TCF6|RL6_ECOL5 50S ribosomal protein L6 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|A1AGJ4|RL6_ECOK1 50S ribosomal protein L6 OS=Escherichia coli O1:K1 / APEC GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|A8A5B0|RL6_ECOHS 50S ribosomal protein L6 OS=Escherichia coli O9:H4 (strain HS) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B1X6F7|RL6_ECODH 50S ribosomal protein L6 OS=Escherichia coli (strain K12 / DH10B) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|C4ZUG0|RL6_ECOBW 50S ribosomal protein L6 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B7M1L9|RL6_ECO8A 50S ribosomal protein L6 OS=Escherichia coli O8 (strain IAI1) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B7N189|RL6_ECO81 50S ribosomal protein L6 OS=Escherichia coli O81 (strain ED1a) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B7NLM4|RL6_ECO7I 50S ribosomal protein L6 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B5YTM6|RL6_ECO5E 50S ribosomal protein L6 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|P0AG57|RL6_ECO57 50S ribosomal protein L6 OS=Escherichia coli O157:H7 GN=rplF PE=3 SV=2 172 293 4.0E-22
sp|B7LI04|RL6_ECO55 50S ribosomal protein L6 OS=Escherichia coli (strain 55989 / EAEC) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B7MCS0|RL6_ECO45 50S ribosomal protein L6 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B7UK29|RL6_ECO27 50S ribosomal protein L6 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|A7ZSJ4|RL6_ECO24 50S ribosomal protein L6 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|Q0I147|RL6_HAES1 50S ribosomal protein L6 OS=Haemophilus somnus (strain 129Pt) GN=rplF PE=3 SV=1 134 293 4.0E-22
sp|B4R8N2|RL6_PHEZH 50S ribosomal protein L6 OS=Phenylobacterium zucineum (strain HLK1) GN=rplF PE=3 SV=1 132 293 4.0E-22
sp|A7MPG5|RL6_CROS8 50S ribosomal protein L6 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplF PE=3 SV=1 172 293 4.0E-22
sp|B2UEK4|RL6_RALPJ 50S ribosomal protein L6 OS=Ralstonia pickettii (strain 12J) GN=rplF PE=3 SV=1 138 293 4.0E-22
sp|B0UX29|RL6_HISS2 50S ribosomal protein L6 OS=Histophilus somni (strain 2336) GN=rplF PE=3 SV=1 134 293 5.0E-22
sp|Q83ER1|RL6_COXBU 50S ribosomal protein L6 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplF PE=3 SV=1 170 293 5.0E-22
sp|A9NAY5|RL6_COXBR 50S ribosomal protein L6 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplF PE=3 SV=1 170 293 5.0E-22
sp|A9KD16|RL6_COXBN 50S ribosomal protein L6 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplF PE=3 SV=1 170 293 5.0E-22
sp|B6J5E7|RL6_COXB1 50S ribosomal protein L6 OS=Coxiella burnetii (strain CbuK_Q154) GN=rplF PE=3 SV=1 170 293 5.0E-22
sp|Q12SU4|RL6_SHEDO 50S ribosomal protein L6 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|B7LRS1|RL6_ESCF3 50S ribosomal protein L6 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|P66313|RL6_SALTY 50S ribosomal protein L6 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplF PE=3 SV=2 172 293 5.0E-22
sp|P66314|RL6_SALTI 50S ribosomal protein L6 OS=Salmonella typhi GN=rplF PE=3 SV=2 172 293 5.0E-22
sp|B4TXC7|RL6_SALSV 50S ribosomal protein L6 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|B5BGX1|RL6_SALPK 50S ribosomal protein L6 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|C0PZW8|RL6_SALPC 50S ribosomal protein L6 OS=Salmonella paratyphi C (strain RKS4594) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|A9MSY3|RL6_SALPB 50S ribosomal protein L6 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|Q5PIU8|RL6_SALPA 50S ribosomal protein L6 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|B4SUS5|RL6_SALNS 50S ribosomal protein L6 OS=Salmonella newport (strain SL254) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|B4TJZ4|RL6_SALHS 50S ribosomal protein L6 OS=Salmonella heidelberg (strain SL476) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|B5RH30|RL6_SALG2 50S ribosomal protein L6 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|B5R1G2|RL6_SALEP 50S ribosomal protein L6 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|Q57J47|RL6_SALCH 50S ribosomal protein L6 OS=Salmonella choleraesuis (strain SC-B67) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|B5F7T0|RL6_SALA4 50S ribosomal protein L6 OS=Salmonella agona (strain SL483) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|B0TLZ7|RL6_SHEHH 50S ribosomal protein L6 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplF PE=3 SV=1 155 293 5.0E-22
sp|Q2NIW9|RL6_AYWBP 50S ribosomal protein L6 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rplF PE=3 SV=2 112 291 5.0E-22
sp|A9MN63|RL6_SALAR 50S ribosomal protein L6 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|A8AQK0|RL6_CITK8 50S ribosomal protein L6 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rplF PE=3 SV=1 172 293 5.0E-22
sp|A6TEV7|RL6_KLEP7 50S ribosomal protein L6 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplF PE=3 SV=1 172 293 6.0E-22
sp|B6EPU0|RL6_ALISL 50S ribosomal protein L6 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplF PE=3 SV=1 172 293 6.0E-22
sp|C5BGL0|RL6_EDWI9 50S ribosomal protein L6 OS=Edwardsiella ictaluri (strain 93-146) GN=rplF PE=3 SV=1 172 293 6.0E-22
sp|A8GKI2|RL6_SERP5 50S ribosomal protein L6 OS=Serratia proteamaculans (strain 568) GN=rplF PE=3 SV=1 172 293 6.0E-22
sp|Q3YWV4|RL6_SHISS 50S ribosomal protein L6 OS=Shigella sonnei (strain Ss046) GN=rplF PE=3 SV=1 172 293 6.0E-22
sp|Q13TI5|RL6_BURXL 50S ribosomal protein L6 OS=Burkholderia xenovorans (strain LB400) GN=rplF PE=3 SV=1 164 293 7.0E-22
sp|Q46IS3|RL6_PROMT 50S ribosomal protein L6 OS=Prochlorococcus marinus (strain NATL2A) GN=rplF PE=3 SV=1 127 291 7.0E-22
sp|Q7M8E7|RL6_WOLSU 50S ribosomal protein L6 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rplF PE=3 SV=1 166 291 7.0E-22
sp|A8GYZ1|RL6_SHEPA 50S ribosomal protein L6 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplF PE=3 SV=1 155 293 8.0E-22
sp|Q2W2K6|RL6_MAGSA 50S ribosomal protein L6 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplF PE=3 SV=1 164 293 8.0E-22
sp|A6LPS6|RL6_CLOB8 50S ribosomal protein L6 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplF PE=3 SV=1 165 291 8.0E-22
sp|Q7A084|RL6_STAAW 50S ribosomal protein L6 OS=Staphylococcus aureus (strain MW2) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|A8Z342|RL6_STAAT 50S ribosomal protein L6 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|Q6G786|RL6_STAAS 50S ribosomal protein L6 OS=Staphylococcus aureus (strain MSSA476) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|Q6GEJ8|RL6_STAAR 50S ribosomal protein L6 OS=Staphylococcus aureus (strain MRSA252) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|Q7A466|RL6_STAAN 50S ribosomal protein L6 OS=Staphylococcus aureus (strain N315) GN=rplF PE=1 SV=1 146 291 8.0E-22
sp|Q99S36|RL6_STAAM 50S ribosomal protein L6 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|A6QJ77|RL6_STAAE 50S ribosomal protein L6 OS=Staphylococcus aureus (strain Newman) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|Q5HDX3|RL6_STAAC 50S ribosomal protein L6 OS=Staphylococcus aureus (strain COL) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|Q2YYL2|RL6_STAAB 50S ribosomal protein L6 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|A5IV19|RL6_STAA9 50S ribosomal protein L6 OS=Staphylococcus aureus (strain JH9) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|Q2FW21|RL6_STAA8 50S ribosomal protein L6 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplF PE=1 SV=1 146 291 8.0E-22
sp|Q2FEQ4|RL6_STAA3 50S ribosomal protein L6 OS=Staphylococcus aureus (strain USA300) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|A6U3W0|RL6_STAA2 50S ribosomal protein L6 OS=Staphylococcus aureus (strain JH1) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|A7X5E1|RL6_STAA1 50S ribosomal protein L6 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplF PE=3 SV=1 146 291 8.0E-22
sp|Q97EJ3|RL6_CLOAB 50S ribosomal protein L6 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rplF PE=3 SV=1 132 288 9.0E-22
sp|B1JIX6|RL6_YERPY 50S ribosomal protein L6 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|Q664T6|RL6_YERPS 50S ribosomal protein L6 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|A4TH07|RL6_YERPP 50S ribosomal protein L6 OS=Yersinia pestis (strain Pestoides F) GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|Q1CCV9|RL6_YERPN 50S ribosomal protein L6 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|A9R910|RL6_YERPG 50S ribosomal protein L6 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|Q7CFT4|RL6_YERPE 50S ribosomal protein L6 OS=Yersinia pestis GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|B2K522|RL6_YERPB 50S ribosomal protein L6 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|Q1C2W2|RL6_YERPA 50S ribosomal protein L6 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|A7FNL9|RL6_YERP3 50S ribosomal protein L6 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|Q7MYG6|RL6_PHOLL 50S ribosomal protein L6 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|B1XJJ3|RL6_SYNP2 50S ribosomal protein L6 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplF PE=3 SV=1 130 291 1.0E-21
sp|Q0BYC9|RL6_HYPNA 50S ribosomal protein L6 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rplF PE=3 SV=1 130 293 1.0E-21
sp|B4F1J9|RL6_PROMH 50S ribosomal protein L6 OS=Proteus mirabilis (strain HI4320) GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|P46181|RL6_BUCAK 50S ribosomal protein L6 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|A7MWH2|RL6_VIBCB 50S ribosomal protein L6 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplF PE=3 SV=1 172 293 1.0E-21
sp|Q6XYX3|RL6_SPIKU 50S ribosomal protein L6 OS=Spiroplasma kunkelii GN=rplF PE=3 SV=1 134 290 1.0E-21
sp|Q12G88|RL6_POLSJ 50S ribosomal protein L6 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rplF PE=3 SV=1 113 282 1.0E-21
sp|A4WFB3|RL6_ENT38 50S ribosomal protein L6 OS=Enterobacter sp. (strain 638) GN=rplF PE=3 SV=1 172 293 2.0E-21
sp|Q87SZ8|RL6_VIBPA 50S ribosomal protein L6 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplF PE=3 SV=1 172 293 2.0E-21
sp|Q9A8T8|RL6_CAUCR 50S ribosomal protein L6 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rplF PE=3 SV=1 148 293 2.0E-21
sp|B8H4E9|RL6_CAUCN 50S ribosomal protein L6 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rplF PE=3 SV=1 148 293 2.0E-21
sp|A1JS15|RL6_YERE8 50S ribosomal protein L6 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplF PE=3 SV=1 172 293 2.0E-21
sp|Q5LW43|RL6_RUEPO 50S ribosomal protein L6 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplF PE=3 SV=1 164 278 2.0E-21
sp|Q7W2E0|RL6_BORPA 50S ribosomal protein L6 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rplF PE=3 SV=1 113 293 2.0E-21
sp|Q7WRA8|RL6_BORBR 50S ribosomal protein L6 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rplF PE=3 SV=1 113 293 2.0E-21
sp|B5FJJ9|RL6_SALDC 50S ribosomal protein L6 OS=Salmonella dublin (strain CT_02021853) GN=rplF PE=3 SV=1 172 293 2.0E-21
sp|Q2NQN7|RL6_SODGM 50S ribosomal protein L6 OS=Sodalis glossinidius (strain morsitans) GN=rplF PE=3 SV=1 170 293 2.0E-21
sp|A6Q1J3|RL6_NITSB 50S ribosomal protein L6 OS=Nitratiruptor sp. (strain SB155-2) GN=rplF PE=3 SV=1 165 291 2.0E-21
sp|A2C4Y5|RL6_PROM1 50S ribosomal protein L6 OS=Prochlorococcus marinus (strain NATL1A) GN=rplF PE=3 SV=1 127 291 2.0E-21
sp|B1LWR1|RL6_METRJ 50S ribosomal protein L6 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplF PE=3 SV=1 134 278 2.0E-21
sp|Q1GK14|RL6_RUEST 50S ribosomal protein L6 OS=Ruegeria sp. (strain TM1040) GN=rplF PE=3 SV=1 155 278 2.0E-21
sp|A0T0J3|RK6_PHATC 50S ribosomal protein L6, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpl6 PE=3 SV=1 132 291 2.0E-21
sp|Q3SSV1|RL6_NITWN 50S ribosomal protein L6 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplF PE=3 SV=1 165 293 2.0E-21
sp|B5FG24|RL6_VIBFM 50S ribosomal protein L6 OS=Vibrio fischeri (strain MJ11) GN=rplF PE=3 SV=1 172 293 3.0E-21
sp|A7IPQ5|RL6_XANP2 50S ribosomal protein L6 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplF PE=3 SV=1 132 278 3.0E-21
sp|Q5E899|RL6_VIBF1 50S ribosomal protein L6 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplF PE=3 SV=1 172 293 3.0E-21
sp|Q6MSP0|RL6_MYCMS 50S ribosomal protein L6 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rplF PE=3 SV=1 165 285 3.0E-21
sp|Q5FTZ8|RL6_GLUOX 50S ribosomal protein L6 OS=Gluconobacter oxydans (strain 621H) GN=rplF PE=3 SV=1 164 293 4.0E-21
sp|A9NEE8|RL6_ACHLI 50S ribosomal protein L6 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplF PE=3 SV=1 113 291 4.0E-21
sp|A1S233|RL6_SHEAM 50S ribosomal protein L6 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplF PE=3 SV=1 132 291 4.0E-21
sp|A7Z0Q3|RL6_BACMF 50S ribosomal protein L6 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rplF PE=3 SV=1 132 291 4.0E-21
sp|Q87E67|RL6_XYLFT 50S ribosomal protein L6 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rplF PE=3 SV=1 170 291 4.0E-21
sp|B2I8I4|RL6_XYLF2 50S ribosomal protein L6 OS=Xylella fastidiosa (strain M23) GN=rplF PE=3 SV=1 170 291 4.0E-21
sp|C0ZIJ5|RL6_BREBN 50S ribosomal protein L6 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rplF PE=3 SV=1 132 291 4.0E-21
sp|A1T0C7|RL6_PSYIN 50S ribosomal protein L6 OS=Psychromonas ingrahamii (strain 37) GN=rplF PE=3 SV=1 168 293 4.0E-21
sp|B8CNE8|RL6_SHEPW 50S ribosomal protein L6 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplF PE=3 SV=1 172 293 4.0E-21
sp|B1KMW8|RL6_SHEWM 50S ribosomal protein L6 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplF PE=3 SV=1 172 293 4.0E-21
sp|P44347|RL6_HAEIN 50S ribosomal protein L6 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplF PE=3 SV=2 172 293 5.0E-21
sp|A5UHU6|RL6_HAEIG 50S ribosomal protein L6 OS=Haemophilus influenzae (strain PittGG) GN=rplF PE=3 SV=1 172 293 5.0E-21
sp|A5UDT2|RL6_HAEIE 50S ribosomal protein L6 OS=Haemophilus influenzae (strain PittEE) GN=rplF PE=3 SV=1 172 293 5.0E-21
sp|Q4QMA6|RL6_HAEI8 50S ribosomal protein L6 OS=Haemophilus influenzae (strain 86-028NP) GN=rplF PE=3 SV=1 172 293 5.0E-21
sp|Q14PJ7|RL6_SPICI 50S ribosomal protein L6 OS=Spiroplasma citri GN=rplF PE=3 SV=1 134 290 5.0E-21
sp|A8G1D3|RL6_SHESH 50S ribosomal protein L6 OS=Shewanella sediminis (strain HAW-EB3) GN=rplF PE=3 SV=1 113 293 6.0E-21
sp|P46898|RL6_BACSU 50S ribosomal protein L6 OS=Bacillus subtilis (strain 168) GN=rplF PE=1 SV=2 132 291 6.0E-21
sp|C4L7U5|RL6_TOLAT 50S ribosomal protein L6 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rplF PE=3 SV=1 124 293 6.0E-21
sp|B2G8W3|RL6_LACRJ 50S ribosomal protein L6 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplF PE=3 SV=1 132 290 6.0E-21
sp|A5VLJ0|RL6_LACRD 50S ribosomal protein L6 OS=Lactobacillus reuteri (strain DSM 20016) GN=rplF PE=3 SV=1 132 290 6.0E-21
sp|B0U5L4|RL6_XYLFM 50S ribosomal protein L6 OS=Xylella fastidiosa (strain M12) GN=rplF PE=3 SV=1 170 291 7.0E-21
sp|Q04G71|RL6_OENOB 50S ribosomal protein L6 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rplF PE=3 SV=1 125 291 7.0E-21
sp|B2IK77|RL6_BEII9 50S ribosomal protein L6 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplF PE=3 SV=1 134 278 7.0E-21
sp|B9M6G3|RL6_GEODF 50S ribosomal protein L6 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplF PE=3 SV=1 130 291 7.0E-21
sp|B1XSR6|RL6_POLNS 50S ribosomal protein L6 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rplF PE=3 SV=1 150 293 7.0E-21
sp|Q7MPH3|RL6_VIBVY 50S ribosomal protein L6 OS=Vibrio vulnificus (strain YJ016) GN=rplF PE=3 SV=1 172 293 7.0E-21
sp|Q8DE55|RL6_VIBVU 50S ribosomal protein L6 OS=Vibrio vulnificus (strain CMCP6) GN=rplF PE=3 SV=1 172 293 7.0E-21
sp|Q8XV27|RL6_RALSO 50S ribosomal protein L6 OS=Ralstonia solanacearum (strain GMI1000) GN=rplF PE=3 SV=1 164 293 8.0E-21
sp|Q488Z8|RL6_COLP3 50S ribosomal protein L6 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplF PE=3 SV=1 127 293 8.0E-21
sp|A0KF36|RL6_AERHH 50S ribosomal protein L6 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplF PE=3 SV=1 172 291 8.0E-21
sp|Q7VTB6|RL6_BORPE 50S ribosomal protein L6 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplF PE=3 SV=1 113 293 9.0E-21
sp|Q2G8W5|RL6_NOVAD 50S ribosomal protein L6 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplF PE=3 SV=1 163 278 9.0E-21
sp|A5F565|RL6_VIBC3 50S ribosomal protein L6 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplF PE=3 SV=1 172 293 1.0E-20
sp|B8F6Q6|RL6_HAEPS 50S ribosomal protein L6 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplF PE=3 SV=1 162 293 1.0E-20
sp|A8GT54|RL6_RICRS 50S ribosomal protein L6 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplF PE=3 SV=1 144 285 1.0E-20
sp|B0BUP5|RL6_RICRO 50S ribosomal protein L6 OS=Rickettsia rickettsii (strain Iowa) GN=rplF PE=3 SV=1 144 285 1.0E-20
sp|Q28UT9|RL6_JANSC 50S ribosomal protein L6 OS=Jannaschia sp. (strain CCS1) GN=rplF PE=3 SV=1 163 293 1.0E-20
sp|B0BSU6|RL6_ACTPJ 50S ribosomal protein L6 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplF PE=3 SV=1 172 293 1.0E-20
sp|B3GZ26|RL6_ACTP7 50S ribosomal protein L6 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplF PE=3 SV=1 172 293 1.0E-20
sp|A3N372|RL6_ACTP2 50S ribosomal protein L6 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplF PE=3 SV=1 172 293 1.0E-20
sp|Q6LVA1|RL6_PHOPR 50S ribosomal protein L6 OS=Photobacterium profundum GN=rplF PE=3 SV=1 172 293 1.0E-20
sp|B8E1E8|RL6_DICTD 50S ribosomal protein L6 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rplF PE=3 SV=1 156 291 1.0E-20
sp|Q8CRH5|RL6_STAES 50S ribosomal protein L6 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplF PE=3 SV=1 146 291 1.0E-20
sp|Q5HM14|RL6_STAEQ 50S ribosomal protein L6 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplF PE=3 SV=1 146 291 1.0E-20
sp|Q2L270|RL6_BORA1 50S ribosomal protein L6 OS=Bordetella avium (strain 197N) GN=rplF PE=3 SV=1 113 293 1.0E-20
sp|Q6MJ27|RL6_BDEBA 50S ribosomal protein L6 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rplF PE=3 SV=1 155 291 1.0E-20
sp|A9KWB7|RL6_SHEB9 50S ribosomal protein L6 OS=Shewanella baltica (strain OS195) GN=rplF PE=3 SV=1 172 293 2.0E-20
sp|A6WHU3|RL6_SHEB8 50S ribosomal protein L6 OS=Shewanella baltica (strain OS185) GN=rplF PE=3 SV=1 172 293 2.0E-20
sp|A3DA57|RL6_SHEB5 50S ribosomal protein L6 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rplF PE=3 SV=1 172 293 2.0E-20
sp|B8EBJ0|RL6_SHEB2 50S ribosomal protein L6 OS=Shewanella baltica (strain OS223) GN=rplF PE=3 SV=1 172 293 2.0E-20
sp|Q6HPP3|RL6_BACHK 50S ribosomal protein L6 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplF PE=3 SV=1 151 291 2.0E-20
sp|Q63H75|RL6_BACCZ 50S ribosomal protein L6 OS=Bacillus cereus (strain ZK / E33L) GN=rplF PE=3 SV=1 151 291 2.0E-20
sp|Q81J27|RL6_BACCR 50S ribosomal protein L6 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rplF PE=3 SV=1 151 291 2.0E-20
sp|Q73F81|RL6_BACC1 50S ribosomal protein L6 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rplF PE=3 SV=1 151 291 2.0E-20
sp|Q81VR5|RL6_BACAN 50S ribosomal protein L6 OS=Bacillus anthracis GN=rplF PE=3 SV=1 151 291 2.0E-20
sp|A8YXM0|RL6_LACH4 50S ribosomal protein L6 OS=Lactobacillus helveticus (strain DPC 4571) GN=rplF PE=3 SV=1 132 291 2.0E-20
sp|Q9PE61|RL6_XYLFA 50S ribosomal protein L6 OS=Xylella fastidiosa (strain 9a5c) GN=rplF PE=3 SV=1 170 291 2.0E-20
sp|A4WVJ3|RL6_RHOS5 50S ribosomal protein L6 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplF PE=3 SV=1 151 293 2.0E-20
sp|A4SUX6|RL6_POLSQ 50S ribosomal protein L6 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rplF PE=3 SV=1 150 293 2.0E-20
sp|Q7VKE8|RL6_HAEDU 50S ribosomal protein L6 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplF PE=3 SV=1 172 293 2.0E-20
sp|A3Q997|RL6_SHELP 50S ribosomal protein L6 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplF PE=3 SV=1 172 293 2.0E-20
sp|Q92GY1|RL6_RICCN 50S ribosomal protein L6 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplF PE=3 SV=1 144 285 2.0E-20
sp|Q211G3|RL6_RHOPB 50S ribosomal protein L6 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplF PE=3 SV=1 162 293 2.0E-20
sp|A4SSZ1|RL6_AERS4 50S ribosomal protein L6 OS=Aeromonas salmonicida (strain A449) GN=rplF PE=3 SV=1 172 291 2.0E-20
sp|P04448|RL6_MYCCT 50S ribosomal protein L6 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rplF PE=3 SV=1 165 285 2.0E-20
sp|Q5FM76|RL6_LACAC 50S ribosomal protein L6 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rplF PE=3 SV=1 132 291 2.0E-20
sp|Q1RHN6|RL6_RICBR 50S ribosomal protein L6 OS=Rickettsia bellii (strain RML369-C) GN=rplF PE=3 SV=1 144 285 2.0E-20
sp|A8GVC9|RL6_RICB8 50S ribosomal protein L6 OS=Rickettsia bellii (strain OSU 85-389) GN=rplF PE=3 SV=1 144 285 2.0E-20
sp|C3PP92|RL6_RICAE 50S ribosomal protein L6 OS=Rickettsia africae (strain ESF-5) GN=rplF PE=3 SV=1 144 285 2.0E-20
sp|A0KRN9|RL6_SHESA 50S ribosomal protein L6 OS=Shewanella sp. (strain ANA-3) GN=rplF PE=3 SV=1 172 293 2.0E-20
sp|Q3AMP4|RL6_SYNSC 50S ribosomal protein L6 OS=Synechococcus sp. (strain CC9605) GN=rplF PE=3 SV=1 112 291 2.0E-20
sp|A6QCR3|RL6_SULNB 50S ribosomal protein L6 OS=Sulfurovum sp. (strain NBC37-1) GN=rplF PE=3 SV=1 163 291 2.0E-20
sp|A4J126|RL6_DESRM 50S ribosomal protein L6 OS=Desulfotomaculum reducens (strain MI-1) GN=rplF PE=3 SV=1 163 286 3.0E-20
sp|Q4L899|RL6_STAHJ 50S ribosomal protein L6 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplF PE=3 SV=1 146 291 3.0E-20
sp|Q0I090|RL6_SHESR 50S ribosomal protein L6 OS=Shewanella sp. (strain MR-7) GN=rplF PE=3 SV=1 172 293 3.0E-20
sp|Q0HNS2|RL6_SHESM 50S ribosomal protein L6 OS=Shewanella sp. (strain MR-4) GN=rplF PE=3 SV=1 172 293 3.0E-20
sp|Q2IXP5|RL6_RHOP2 50S ribosomal protein L6 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplF PE=3 SV=1 170 293 3.0E-20
sp|C3LRP3|RL6_VIBCM 50S ribosomal protein L6 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplF PE=3 SV=1 172 293 3.0E-20
sp|Q9KNZ9|RL6_VIBCH 50S ribosomal protein L6 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplF PE=3 SV=1 172 293 3.0E-20
sp|B0JHY9|RL6_MICAN 50S ribosomal protein L6 OS=Microcystis aeruginosa (strain NIES-843) GN=rplF PE=3 SV=1 127 289 3.0E-20
sp|Q1QN15|RL6_NITHX 50S ribosomal protein L6 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplF PE=3 SV=1 170 293 3.0E-20
sp|A1REC9|RL6_SHESW 50S ribosomal protein L6 OS=Shewanella sp. (strain W3-18-1) GN=rplF PE=3 SV=1 172 293 3.0E-20
sp|A4YBW8|RL6_SHEPC 50S ribosomal protein L6 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplF PE=3 SV=1 172 293 3.0E-20
sp|Q65P92|RL6_BACLD 50S ribosomal protein L6 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplF PE=3 SV=1 132 291 3.0E-20
sp|Q8EK54|RL6_SHEON 50S ribosomal protein L6 OS=Shewanella oneidensis (strain MR-1) GN=rplF PE=3 SV=1 172 293 3.0E-20
sp|Q1AU44|RL6_RUBXD 50S ribosomal protein L6 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplF PE=3 SV=1 150 291 3.0E-20
sp|Q4UMR4|RL6_RICFE 50S ribosomal protein L6 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rplF PE=3 SV=1 144 285 3.0E-20
sp|C4K2G4|RL6_RICPU 50S ribosomal protein L6 OS=Rickettsia peacockii (strain Rustic) GN=rplF PE=3 SV=1 144 285 3.0E-20
sp|C1A6S0|RL6_GEMAT 50S ribosomal protein L6 OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=rplF PE=3 SV=1 130 291 3.0E-20
sp|A8GPD5|RL6_RICAH 50S ribosomal protein L6 OS=Rickettsia akari (strain Hartford) GN=rplF PE=3 SV=1 132 285 3.0E-20
sp|Q16AC9|RL6_ROSDO 50S ribosomal protein L6 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplF PE=3 SV=1 155 278 4.0E-20
sp|B5YDV8|RL6_DICT6 50S ribosomal protein L6 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rplF PE=3 SV=1 156 291 4.0E-20
sp|A4SCS4|RL6_CHLPM 50S ribosomal protein L6 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rplF PE=3 SV=1 157 288 4.0E-20
sp|Q2S3P9|RL6_SALRD 50S ribosomal protein L6 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rplF PE=3 SV=1 113 291 4.0E-20
sp|Q2JIL3|RL6_SYNJB 50S ribosomal protein L6 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rplF PE=3 SV=1 130 284 4.0E-20
sp|Q98PZ7|RL6_MYCPU 50S ribosomal protein L6 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rplF PE=3 SV=1 156 288 4.0E-20
sp|B2GDV4|RL6_LACF3 50S ribosomal protein L6 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rplF PE=3 SV=1 127 290 4.0E-20
sp|A7HWS6|RL6_PARL1 50S ribosomal protein L6 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplF PE=3 SV=1 132 278 5.0E-20
sp|A9IHT3|RL6_BORPD 50S ribosomal protein L6 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rplF PE=3 SV=1 113 293 5.0E-20
sp|Q1CRV6|RL6_HELPH 50S ribosomal protein L6 OS=Helicobacter pylori (strain HPAG1) GN=rplF PE=3 SV=1 166 291 5.0E-20
sp|P73306|RL6_SYNY3 50S ribosomal protein L6 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplF PE=3 SV=1 127 291 5.0E-20
sp|Q134U4|RL6_RHOPS 50S ribosomal protein L6 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplF PE=3 SV=1 170 293 5.0E-20
sp|Q03PX2|RL6_LACBA 50S ribosomal protein L6 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplF PE=3 SV=1 163 291 5.0E-20
sp|A8F2D2|RL6_RICM5 50S ribosomal protein L6 OS=Rickettsia massiliae (strain Mtu5) GN=rplF PE=3 SV=1 144 285 6.0E-20
sp|B1I1L4|RL6_DESAP 50S ribosomal protein L6 OS=Desulforudis audaxviator (strain MP104C) GN=rplF PE=3 SV=1 170 291 6.0E-20
sp|Q3J5Q7|RL6_RHOS4 50S ribosomal protein L6 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplF PE=3 SV=1 163 293 6.0E-20
sp|A3PGM6|RL6_RHOS1 50S ribosomal protein L6 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplF PE=3 SV=1 163 293 6.0E-20
sp|A5FZV0|RL6_ACICJ 50S ribosomal protein L6 OS=Acidiphilium cryptum (strain JF-5) GN=rplF PE=3 SV=1 132 293 6.0E-20
sp|Q9Z9J9|RL6_BACHD 50S ribosomal protein L6 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplF PE=3 SV=1 132 291 6.0E-20
sp|Q7V531|RL6_PROMM 50S ribosomal protein L6 OS=Prochlorococcus marinus (strain MIT 9313) GN=rplF PE=3 SV=1 127 291 6.0E-20
sp|B5EFR5|RL6_GEOBB 50S ribosomal protein L6 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rplF PE=3 SV=1 166 291 6.0E-20
sp|B9KEF5|RL6_CAMLR 50S ribosomal protein L6 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rplF PE=3 SV=1 165 291 6.0E-20
sp|Q6A6P1|RL6_PROAC 50S ribosomal protein L6 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rplF PE=3 SV=1 130 291 6.0E-20
sp|B3E0J9|RL6_METI4 50S ribosomal protein L6 OS=Methylacidiphilum infernorum (isolate V4) GN=rplF PE=3 SV=1 157 291 7.0E-20
sp|B8ELE8|RL6_METSB 50S ribosomal protein L6 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplF PE=3 SV=1 165 278 8.0E-20
sp|B5Z8V2|RL6_HELPG 50S ribosomal protein L6 OS=Helicobacter pylori (strain G27) GN=rplF PE=3 SV=1 132 291 8.0E-20
sp|A1B042|RL6_PARDP 50S ribosomal protein L6 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplF PE=3 SV=1 151 278 9.0E-20
sp|Q0ANR5|RL6_MARMM 50S ribosomal protein L6 OS=Maricaulis maris (strain MCS10) GN=rplF PE=3 SV=1 132 293 9.0E-20
sp|A4TEC2|RL6_MYCGI 50S ribosomal protein L6 OS=Mycobacterium gilvum (strain PYR-GCK) GN=rplF PE=3 SV=1 127 291 1.0E-19
sp|B3QBW5|RL6_RHOPT 50S ribosomal protein L6 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplF PE=3 SV=1 168 293 1.0E-19
sp|Q6N4U8|RL6_RHOPA 50S ribosomal protein L6 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplF PE=1 SV=3 168 293 1.0E-19
sp|Q5HSA5|RL6_CAMJR 50S ribosomal protein L6 OS=Campylobacter jejuni (strain RM1221) GN=rplF PE=3 SV=1 165 291 1.0E-19
sp|A1W1U5|RL6_CAMJJ 50S ribosomal protein L6 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rplF PE=3 SV=1 165 291 1.0E-19
sp|Q0P7T9|RL6_CAMJE 50S ribosomal protein L6 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rplF PE=3 SV=1 165 291 1.0E-19
sp|A8FP06|RL6_CAMJ8 50S ribosomal protein L6 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rplF PE=3 SV=1 165 291 1.0E-19
sp|B0TC71|RL6_HELMI 50S ribosomal protein L6 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplF PE=3 SV=1 151 286 1.0E-19
sp|Q39XZ1|RL6_GEOMG 50S ribosomal protein L6 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplF PE=3 SV=1 151 291 1.0E-19
sp|B2A4F4|RL6_NATTJ 50S ribosomal protein L6 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplF PE=3 SV=1 132 286 1.0E-19
sp|Q68W93|RL6_RICTY 50S ribosomal protein L6 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplF PE=3 SV=1 144 288 1.0E-19
sp|Q9ZCS0|RL6_RICPR 50S ribosomal protein L6 OS=Rickettsia prowazekii (strain Madrid E) GN=rplF PE=3 SV=1 144 288 1.0E-19
sp|A4VSG8|RL6_STRSY 50S ribosomal protein L6 OS=Streptococcus suis (strain 05ZYH33) GN=rplF PE=3 SV=1 163 278 1.0E-19
sp|A4VYQ7|RL6_STRS2 50S ribosomal protein L6 OS=Streptococcus suis (strain 98HAH33) GN=rplF PE=3 SV=1 163 278 1.0E-19
sp|B8I7Z4|RL6_CLOCE 50S ribosomal protein L6 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rplF PE=3 SV=1 163 286 1.0E-19
sp|B6JEY0|RL6_OLICO 50S ribosomal protein L6 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplF PE=3 SV=1 162 291 1.0E-19
sp|B9JDU3|RL6_AGRRK 50S ribosomal protein L6 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rplF PE=3 SV=1 163 291 2.0E-19
sp|P56034|RL6_HELPY 50S ribosomal protein L6 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rplF PE=3 SV=1 132 291 2.0E-19
sp|B2UV67|RL6_HELPS 50S ribosomal protein L6 OS=Helicobacter pylori (strain Shi470) GN=rplF PE=3 SV=1 132 291 2.0E-19
sp|A8AZL0|RL6_STRGC 50S ribosomal protein L6 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rplF PE=3 SV=1 163 278 2.0E-19
sp|B5YG32|RL6_THEYD 50S ribosomal protein L6 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rplF PE=3 SV=1 130 288 2.0E-19
sp|C6C1A0|RL6_DESAD 50S ribosomal protein L6 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rplF PE=3 SV=1 163 291 2.0E-19
sp|B9MKG6|RL6_CALBD 50S ribosomal protein L6 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rplF PE=3 SV=1 127 287 2.0E-19
sp|Q17ZC4|RL6_HELAH 50S ribosomal protein L6 OS=Helicobacter acinonychis (strain Sheeba) GN=rplF PE=3 SV=1 132 291 2.0E-19
sp|B6IRS1|RL6_RHOCS 50S ribosomal protein L6 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplF PE=3 SV=1 124 291 2.0E-19
sp|Q49ZF3|RL6_STAS1 50S ribosomal protein L6 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplF PE=3 SV=1 145 291 2.0E-19
sp|A5ELL2|RL6_BRASB 50S ribosomal protein L6 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplF PE=3 SV=1 165 278 2.0E-19
sp|B3PMN2|RL6_MYCA5 50S ribosomal protein L6 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rplF PE=3 SV=1 158 288 2.0E-19
sp|A4XLR5|RL6_CALS8 50S ribosomal protein L6 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rplF PE=3 SV=1 127 287 2.0E-19
sp|A5GIT1|RL6_SYNPW 50S ribosomal protein L6 OS=Synechococcus sp. (strain WH7803) GN=rplF PE=3 SV=1 130 291 3.0E-19
sp|Q8ETW8|RL6_OCEIH 50S ribosomal protein L6 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplF PE=3 SV=1 165 291 3.0E-19
sp|A8EZK1|RL6_RICCK 50S ribosomal protein L6 OS=Rickettsia canadensis (strain McKiel) GN=rplF PE=3 SV=1 164 285 3.0E-19
sp|A3CK79|RL6_STRSV 50S ribosomal protein L6 OS=Streptococcus sanguinis (strain SK36) GN=rplF PE=3 SV=1 163 278 3.0E-19
sp|Q8YPJ3|RL6_NOSS1 50S ribosomal protein L6 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplF PE=3 SV=1 130 278 3.0E-19
sp|Q3MFA7|RL6_ANAVT 50S ribosomal protein L6 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplF PE=3 SV=1 130 278 3.0E-19
sp|A4YSK7|RL6_BRASO 50S ribosomal protein L6 OS=Bradyrhizobium sp. (strain ORS278) GN=rplF PE=3 SV=1 165 278 3.0E-19
sp|Q1WSA5|RL6_LACS1 50S ribosomal protein L6 OS=Lactobacillus salivarius (strain UCC118) GN=rplF PE=3 SV=1 130 278 4.0E-19
sp|Q07KN3|RL6_RHOP5 50S ribosomal protein L6 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplF PE=3 SV=1 168 291 4.0E-19
sp|Q4A5D6|RL6_MYCS5 50S ribosomal protein L6 OS=Mycoplasma synoviae (strain 53) GN=rplF PE=3 SV=1 157 288 5.0E-19
sp|C5CGI7|RL6_KOSOT 50S ribosomal protein L6 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rplF PE=3 SV=1 112 291 5.0E-19
sp|A6X0D3|RL6_OCHA4 50S ribosomal protein L6 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplF PE=3 SV=1 163 291 5.0E-19
sp|A5GVX4|RL6_SYNR3 50S ribosomal protein L6 OS=Synechococcus sp. (strain RCC307) GN=rplF PE=3 SV=1 130 291 5.0E-19
sp|Q57CS3|RL6_BRUAB 50S ribosomal protein L6 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplF PE=3 SV=1 163 291 5.0E-19
sp|Q2YRB0|RL6_BRUA2 50S ribosomal protein L6 OS=Brucella abortus (strain 2308) GN=rplF PE=3 SV=1 163 291 5.0E-19
sp|B2S664|RL6_BRUA1 50S ribosomal protein L6 OS=Brucella abortus (strain S19) GN=rplF PE=3 SV=1 163 291 5.0E-19
sp|Q89J99|RL6_BRADU 50S ribosomal protein L6 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplF PE=3 SV=1 162 291 5.0E-19
sp|Q250L7|RL6_DESHY 50S ribosomal protein L6 OS=Desulfitobacterium hafniense (strain Y51) GN=rplF PE=3 SV=1 127 286 6.0E-19
sp|B8G1Y1|RL6_DESHD 50S ribosomal protein L6 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplF PE=3 SV=1 127 286 6.0E-19
sp|Q8G087|RL6_BRUSU 50S ribosomal protein L6 OS=Brucella suis biovar 1 (strain 1330) GN=rplF PE=3 SV=1 163 291 6.0E-19
sp|B0CH17|RL6_BRUSI 50S ribosomal protein L6 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rplF PE=3 SV=1 163 291 6.0E-19
sp|A5VQZ1|RL6_BRUO2 50S ribosomal protein L6 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rplF PE=3 SV=1 163 291 6.0E-19
sp|C0RJI6|RL6_BRUMB 50S ribosomal protein L6 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplF PE=3 SV=1 163 291 6.0E-19
sp|A9M5N5|RL6_BRUC2 50S ribosomal protein L6 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rplF PE=3 SV=1 163 291 6.0E-19
sp|A1ALV6|RL6_PELPD 50S ribosomal protein L6 OS=Pelobacter propionicus (strain DSM 2379) GN=rplF PE=3 SV=1 172 291 6.0E-19
sp|B1MW00|RL6_LEUCK 50S ribosomal protein L6 OS=Leuconostoc citreum (strain KM20) GN=rplF PE=3 SV=1 130 291 6.0E-19
sp|Q97SU7|RL6_STRPN 50S ribosomal protein L6 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rplF PE=3 SV=1 163 278 6.0E-19
sp|B6JNE3|RL6_HELP2 50S ribosomal protein L6 OS=Helicobacter pylori (strain P12) GN=rplF PE=3 SV=1 132 291 7.0E-19
sp|B5E6H0|RL6_STRP4 50S ribosomal protein L6 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rplF PE=3 SV=1 163 278 7.0E-19
sp|A0QSG4|RL6_MYCS2 50S ribosomal protein L6 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rplF PE=1 SV=1 127 291 7.0E-19
sp|Q6G2Y0|RL6_BARHE 50S ribosomal protein L6 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplF PE=3 SV=1 151 293 7.0E-19
sp|C1CPA3|RL6_STRZT 50S ribosomal protein L6 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rplF PE=3 SV=1 163 278 7.0E-19
sp|C1CIB2|RL6_STRZP 50S ribosomal protein L6 OS=Streptococcus pneumoniae (strain P1031) GN=rplF PE=3 SV=1 163 278 7.0E-19
sp|C1CC21|RL6_STRZJ 50S ribosomal protein L6 OS=Streptococcus pneumoniae (strain JJA) GN=rplF PE=3 SV=1 163 278 7.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0019843 rRNA binding Yes
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043228 non-membrane-bounded organelle No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043604 amide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043043 peptide biosynthetic process No
GO:0003723 RNA binding No
GO:0005198 structural molecule activity No
GO:0097159 organic cyclic compound binding No
GO:0005575 cellular_component No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043229 intracellular organelle No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0043603 cellular amide metabolic process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3852
MMASDNLGDVEPTRTSHRDRGIPTPLPFYDDQHLVLHPGNSPIPGVSQINGSGARSGAGGAPSAADAGCDGGTTT
TLLGHGAAGVEARTYAYIPAAGGGCGDRGCVDFEQHDGLEADCKEDDYGQGSAGGPRVGTLKLDIPHYVTMSENK
EEKTVQLTIEDINAKQQKEMWGTSWAYLNNHIRGVSEGHTAILRLVGVGYRAVVSPRRAKEEYPGQRFLCLKLGF
THPVEEGIPEGVHVSTPSPTRILVEGPDREALMSFAGRVRKWRPPEPYKGKGIFINDQTIKLKAKKIK
Coding >Ophio5|3852
ATGATGGCCAGTGACAACCTCGGCGACGTCGAACCTACACGAACCTCTCACCGAGACCGAGGGATACCAACGCCC
CTTCCCTTCTACGACGACCAGCACCTGGTGCTTCACCCTGGGAACTCTCCGATCCCGGGGGTGTCACAGATCAAT
GGCAGCGGTGCTCGCTCCGGCGCGGGCGGTGCGCCATCCGCTGCGGACGCTGGTTGCGACGGCGGCACGACGACG
ACCCTTCTCGGCCACGGCGCGGCAGGCGTCGAAGCTAGGACGTACGCCTATATTCCTGCCGCCGGGGGTGGATGT
GGCGATAGGGGATGCGTGGACTTTGAACAGCATGACGGATTGGAAGCCGATTGTAAAGAAGACGATTACGGTCAA
GGGTCCGCTGGAGGGCCGAGAGTAGGGACGTTGAAGCTTGACATCCCCCATTACGTGACCATGAGCGAGAATAAG
GAGGAGAAGACGGTACAGCTTACCATTGAAGATATCAACGCGAAGCAACAAAAGGAGATGTGGGGAACGTCGTGG
GCATATCTCAACAACCATATACGAGGCGTATCCGAAGGGCACACGGCCATCCTACGCCTCGTCGGCGTAGGGTAT
CGCGCCGTCGTGTCGCCTCGTCGTGCCAAGGAGGAGTATCCCGGCCAGCGCTTCCTCTGCCTCAAGCTGGGCTTC
ACCCATCCCGTCGAGGAGGGCATCCCCGAGGGCGTTCATGTCTCGACTCCCTCGCCGACTCGCATCCTTGTCGAG
GGTCCTGATCGAGAGGCTCTCATGTCCTTTGCCGGACGCGTCAGGAAGTGGCGCCCGCCTGAGCCGTACAAGGGG
AAGGGCATCTTTATCAACGATCAGACTATCAAGCTGAAGGCGAAGAAGATCAAG
Transcript >Ophio5|3852
ATGATGGCCAGTGACAACCTCGGCGACGTCGAACCTACACGAACCTCTCACCGAGACCGAGGGATACCAACGCCC
CTTCCCTTCTACGACGACCAGCACCTGGTGCTTCACCCTGGGAACTCTCCGATCCCGGGGGTGTCACAGATCAAT
GGCAGCGGTGCTCGCTCCGGCGCGGGCGGTGCGCCATCCGCTGCGGACGCTGGTTGCGACGGCGGCACGACGACG
ACCCTTCTCGGCCACGGCGCGGCAGGCGTCGAAGCTAGGACGTACGCCTATATTCCTGCCGCCGGGGGTGGATGT
GGCGATAGGGGATGCGTGGACTTTGAACAGCATGACGGATTGGAAGCCGATTGTAAAGAAGACGATTACGGTCAA
GGGTCCGCTGGAGGGCCGAGAGTAGGGACGTTGAAGCTTGACATCCCCCATTACGTGACCATGAGCGAGAATAAG
GAGGAGAAGACGGTACAGCTTACCATTGAAGATATCAACGCGAAGCAACAAAAGGAGATGTGGGGAACGTCGTGG
GCATATCTCAACAACCATATACGAGGCGTATCCGAAGGGCACACGGCCATCCTACGCCTCGTCGGCGTAGGGTAT
CGCGCCGTCGTGTCGCCTCGTCGTGCCAAGGAGGAGTATCCCGGCCAGCGCTTCCTCTGCCTCAAGCTGGGCTTC
ACCCATCCCGTCGAGGAGGGCATCCCCGAGGGCGTTCATGTCTCGACTCCCTCGCCGACTCGCATCCTTGTCGAG
GGTCCTGATCGAGAGGCTCTCATGTCCTTTGCCGGACGCGTCAGGAAGTGGCGCCCGCCTGAGCCGTACAAGGGG
AAGGGCATCTTTATCAACGATCAGACTATCAAGCTGAAGGCGAAGAAGATCAAGTAG
Gene >Ophio5|3852
ATGATGGCCAGTGACAAGTAACAGTATCATTACGTGACGCGTGTCGAGGCCAGCAACCGATGCATCGTGACGCTG
CAGTCCATCTGCGAGCCTCTCCTTCACGTTGTTGGTGGAGCATCACGTGCACGTGACTAAGCGACAAAAAGCCTC
GGCGACGTCGAACCTACACGAACCTCTCACCGAGACCGAGGGATACCAACGCCCCTTCCCTTCTACGACGACCAG
CACCTGGTGCTTCACCCTGGGAACTCTCCGATCCCGGGGGTGTCACAGATCAATGGCAGCGGTGCTCGCTCCGGC
GCGGGCGGTGCGCCATCCGCTGCGGACGCTGGTTGCGACGGCGGCACGACGACGACCCTTCTCGGCCACGGCGCG
GCAGGCGTCGAAGCTAGGACGTACGCCTATATTCCTGCCGCCGGGGGTGGATGTGGCGATAGGGGATGCGTGGAC
TTTGAACAGCATGACGGATTGGAAGCCGATTGTAAAGAAGACGATTACGGTCAAGGGTCCGCTGGGTGAGTTTGT
TCGCTCTCGCGGGGGAGGTGAAGGGGAAGGGGGAAAGGTTTCAAGCGGGGAATGGGCTTGGGTGCTAACTCTAGG
GGCCCTAGAGGGCCGAGAGTAGGGACGTTGAAGCTTGACATCCCCCATTACGTGACCATGAGCGAGAATAAGGAG
GAGAAGACGGTACAGCTTACCATTGAAGATATCAACGCGAAGCAACAAAAGGAGATGTGGGGTACGTCTCGTTCC
CCAGTTTGAGTCTATTCGACTGTCCCCCTATTGCAGTGTCTATGTCTGCAACTCGCTTCTCCCGCTGACGACGCT
TCCTCTACCTCCTCCTCCTCTTCTTCTTACAGGAACGTCGTGGGCATATCTCAACAACCATATACGAGGCGTATC
CGAAGGGCACACGGCCATCCTACGCCTCGTCGGCGTAGGGTATCGCGCCGTCGTGTCGCCTCGTCGTGCCAAGGA
GGAGTATCCCGGCCAGCGCTTCCTCTGCCTCAAGCTGGGCTTCACCCATCCCGTCGAGGAGGGCATCCCCGAGGG
CGTTCATGTCTCGACTCCCTCGCCGACTCGCATCCTTGTCGAGGGTCCTGATCGAGAGGCTCTCATGTCCTTTGC
CGGACGCGTCAGGAAGTGGCGCCCGCCTGAGCCGTACAAGGGGAAGGGCATCTTTATCAACGATCAGACTATCAA
GCTGAAGGCGAAGAAGATCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail