Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|385
Gene name
Locationscaffold_109:35076..37446
Strand+
Gene length (bp)2370
Transcript length (bp)1875
Coding sequence length (bp)1872
Protein length (aa) 624

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09779 Ima1_N Ima1 N-terminal domain 7.0E-34 10 133

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13681|IINMP_SCHPO Integral inner nuclear membrane protein ima1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=IMA1 PE=4 SV=2 8 288 2.0E-24

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 269 291 22
2 298 315 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|385
MARFRAARHLNCFYCGRRSGIRNDGKTLEFVCRYCEATNYLDEKGEITDPPVATDGEATMTQFAAPKPPSQTDSI
FCSACLKNQYLLTASLAQYLPDDPSDPDYAPLERNYHRYRRGLEKRYPQVCDQCAGRVEARLRQAGYTAKTDHLR
RMMELGRGKRTASKNGLLDWVSCLGGVIWRAGFALQLLWHLVAVAPLLRDGGDGLRDPNEAGLSVTATAWLGSVA
DVLPGPDVLVRWTVAAAVASVWWNPYFVQLFRGFTRHLTGFKQWYSFQSLIVVFRLVCWGLVGVGAQSRQAQLSL
HMAMASVMTLIYVFSRKSMRVDTSPLFGAGSSSGLKEAAMTPTRAPAAPNKHLTQPAACTEASLQQLPSRLSRNP
RPSAAAAGPPSPNKGMGIDKSPFWYKVPAAPVTPARQLRNPPRAPDVKPAMLETDRFAFSPATTREKGRGQSTAG
VEFRQPQFFAPERDDANSLADLLGQSFSLSQDRDQEGDDDDDDDDNNDDDDDGKVTTLGGQGKSRRTATSSARRL
SHGGASTWHRRLVEPVALIVLPIMWALTLTSAVPFRNECQAAIIAMSGLMTFLGAGEERHGSRSEQVLAAWATAE
LAASFWVFYALSTDGEAPCRRRPS
Coding >Ophio5|385
ATGGCGCGCTTCCGGGCAGCGAGGCACCTGAATTGCTTCTACTGCGGGCGACGATCTGGAATACGGAACGATGGC
AAGACGCTCGAGTTTGTGTGTCGCTACTGCGAGGCGACCAACTATCTCGACGAGAAGGGCGAAATCACCGACCCC
CCCGTCGCTACAGATGGTGAAGCTACGATGACGCAGTTCGCAGCACCGAAACCACCTTCTCAGACAGACAGCATA
TTCTGCTCAGCCTGCCTCAAGAACCAATACCTGCTGACGGCTTCGTTGGCGCAATACCTCCCCGACGATCCTTCT
GACCCGGACTACGCGCCGCTGGAGCGCAACTACCACCGATATCGCCGCGGCCTGGAGAAGCGCTACCCACAGGTG
TGTGACCAATGCGCCGGCCGGGTCGAGGCGCGACTGCGGCAGGCGGGCTATACGGCCAAGACGGATCATCTGCGG
CGAATGATGGAGTTGGGCCGTGGTAAGAGGACGGCTTCGAAGAATGGGCTTCTGGATTGGGTTTCCTGTCTGGGA
GGTGTCATCTGGAGGGCGGGGTTTGCCTTACAGCTGCTGTGGCATCTTGTTGCCGTCGCTCCGCTTCTAAGAGAC
GGAGGCGACGGCTTGCGAGATCCGAACGAGGCAGGCCTTTCGGTTACAGCGACGGCCTGGCTTGGAAGCGTGGCG
GATGTGCTTCCTGGGCCGGATGTGCTCGTTCGCTGGACCGTGGCGGCAGCTGTTGCGTCGGTATGGTGGAATCCT
TACTTTGTCCAGCTATTTCGGGGCTTCACGAGGCATTTGACTGGCTTCAAGCAGTGGTATTCCTTCCAGAGCCTG
ATCGTCGTCTTCCGCCTTGTCTGCTGGGGCCTTGTCGGCGTCGGGGCTCAGTCACGTCAGGCACAGCTGAGCCTT
CATATGGCCATGGCGTCTGTCATGACACTGATATACGTCTTTTCGCGCAAGTCGATGCGCGTCGACACGTCGCCC
CTATTTGGCGCCGGCTCCAGTTCCGGGCTCAAAGAAGCGGCCATGACTCCGACAAGGGCACCGGCGGCCCCCAAC
AAGCATCTCACCCAGCCCGCTGCCTGCACAGAGGCAAGCCTACAACAACTCCCTAGCCGTCTATCGCGAAACCCC
CGGCCTTCTGCCGCAGCAGCAGGCCCACCGTCTCCGAACAAGGGCATGGGCATAGACAAGAGCCCCTTTTGGTAC
AAGGTCCCCGCAGCGCCGGTGACGCCCGCGCGACAGCTAAGGAATCCTCCGAGGGCGCCGGATGTGAAGCCGGCC
ATGTTGGAGACGGATAGATTCGCCTTTTCGCCGGCGACGACGCGCGAAAAGGGGCGCGGTCAGAGCACCGCTGGG
GTGGAGTTCCGGCAGCCGCAGTTTTTCGCGCCGGAGCGGGACGACGCCAACTCGTTGGCTGATCTCCTGGGCCAG
AGCTTTAGTCTGAGCCAGGACCGTGACCAGGAGGGCGATGACGATGACGATGACGACGATAATAATGATGATGAT
GATGATGGAAAGGTTACGACACTCGGCGGTCAAGGGAAGAGTCGGAGGACGGCCACGTCGTCGGCCAGGAGGCTA
TCTCACGGAGGGGCAAGCACATGGCATCGCCGCCTCGTCGAACCCGTCGCGCTCATCGTTCTACCTATCATGTGG
GCGCTGACACTGACCTCTGCCGTGCCCTTCCGAAACGAGTGCCAGGCGGCGATCATAGCCATGTCCGGACTCATG
ACCTTTCTCGGCGCCGGCGAGGAGCGGCACGGCTCCAGGTCCGAGCAGGTCCTGGCAGCATGGGCGACTGCAGAG
CTGGCGGCCTCTTTTTGGGTCTTCTATGCGCTGTCGACGGATGGAGAGGCGCCGTGCCGTCGACGGCCGTCA
Transcript >Ophio5|385
ATGGCGCGCTTCCGGGCAGCGAGGCACCTGAATTGCTTCTACTGCGGGCGACGATCTGGAATACGGAACGATGGC
AAGACGCTCGAGTTTGTGTGTCGCTACTGCGAGGCGACCAACTATCTCGACGAGAAGGGCGAAATCACCGACCCC
CCCGTCGCTACAGATGGTGAAGCTACGATGACGCAGTTCGCAGCACCGAAACCACCTTCTCAGACAGACAGCATA
TTCTGCTCAGCCTGCCTCAAGAACCAATACCTGCTGACGGCTTCGTTGGCGCAATACCTCCCCGACGATCCTTCT
GACCCGGACTACGCGCCGCTGGAGCGCAACTACCACCGATATCGCCGCGGCCTGGAGAAGCGCTACCCACAGGTG
TGTGACCAATGCGCCGGCCGGGTCGAGGCGCGACTGCGGCAGGCGGGCTATACGGCCAAGACGGATCATCTGCGG
CGAATGATGGAGTTGGGCCGTGGTAAGAGGACGGCTTCGAAGAATGGGCTTCTGGATTGGGTTTCCTGTCTGGGA
GGTGTCATCTGGAGGGCGGGGTTTGCCTTACAGCTGCTGTGGCATCTTGTTGCCGTCGCTCCGCTTCTAAGAGAC
GGAGGCGACGGCTTGCGAGATCCGAACGAGGCAGGCCTTTCGGTTACAGCGACGGCCTGGCTTGGAAGCGTGGCG
GATGTGCTTCCTGGGCCGGATGTGCTCGTTCGCTGGACCGTGGCGGCAGCTGTTGCGTCGGTATGGTGGAATCCT
TACTTTGTCCAGCTATTTCGGGGCTTCACGAGGCATTTGACTGGCTTCAAGCAGTGGTATTCCTTCCAGAGCCTG
ATCGTCGTCTTCCGCCTTGTCTGCTGGGGCCTTGTCGGCGTCGGGGCTCAGTCACGTCAGGCACAGCTGAGCCTT
CATATGGCCATGGCGTCTGTCATGACACTGATATACGTCTTTTCGCGCAAGTCGATGCGCGTCGACACGTCGCCC
CTATTTGGCGCCGGCTCCAGTTCCGGGCTCAAAGAAGCGGCCATGACTCCGACAAGGGCACCGGCGGCCCCCAAC
AAGCATCTCACCCAGCCCGCTGCCTGCACAGAGGCAAGCCTACAACAACTCCCTAGCCGTCTATCGCGAAACCCC
CGGCCTTCTGCCGCAGCAGCAGGCCCACCGTCTCCGAACAAGGGCATGGGCATAGACAAGAGCCCCTTTTGGTAC
AAGGTCCCCGCAGCGCCGGTGACGCCCGCGCGACAGCTAAGGAATCCTCCGAGGGCGCCGGATGTGAAGCCGGCC
ATGTTGGAGACGGATAGATTCGCCTTTTCGCCGGCGACGACGCGCGAAAAGGGGCGCGGTCAGAGCACCGCTGGG
GTGGAGTTCCGGCAGCCGCAGTTTTTCGCGCCGGAGCGGGACGACGCCAACTCGTTGGCTGATCTCCTGGGCCAG
AGCTTTAGTCTGAGCCAGGACCGTGACCAGGAGGGCGATGACGATGACGATGACGACGATAATAATGATGATGAT
GATGATGGAAAGGTTACGACACTCGGCGGTCAAGGGAAGAGTCGGAGGACGGCCACGTCGTCGGCCAGGAGGCTA
TCTCACGGAGGGGCAAGCACATGGCATCGCCGCCTCGTCGAACCCGTCGCGCTCATCGTTCTACCTATCATGTGG
GCGCTGACACTGACCTCTGCCGTGCCCTTCCGAAACGAGTGCCAGGCGGCGATCATAGCCATGTCCGGACTCATG
ACCTTTCTCGGCGCCGGCGAGGAGCGGCACGGCTCCAGGTCCGAGCAGGTCCTGGCAGCATGGGCGACTGCAGAG
CTGGCGGCCTCTTTTTGGGTCTTCTATGCGCTGTCGACGGATGGAGAGGCGCCGTGCCGTCGACGGCCGTCATGA
Gene >Ophio5|385
ATGGCGCGCTTCCGGGCAGCGAGGCACCTGAATTGCTTCTACTGCGGGCGACGATCTGGAATACGGAACGATGGC
AAGACGCTCGAGTTTGTGTGTCGCTACTGCGAGGCGACCAACTATCTCGACGAGGTGCCCCTCCCTCTCTCTCTC
CCTCTCTTCCTCCTTTCCTTGACGATGCCATCAAGAGACTGACTGGCTGACGACAACGCGAGTAGAAGGGCGAAA
TCACCGACCCCCCCGTCGCTACAGATGGTGAAGCTACGATGACGCAGTTCGCAGCACCGAAACCACCTTCTCAGA
CAGACAGCATATTCTGCTCAGCCTGCCTCAAGAACCAATACCTGCTGACGGCTTCGTTGGCGCAATACCTCCCCG
ACGATCCTTCTGACCCGGACTACGCGCCGCTGGAGCGCAACTACCACCGATATCGCCGCGGCCTGGAGAAGCGCT
ACCCACAGGTGTGTGACCAATGCGCCGGCCGGGTCGAGGCGCGACTGCGGCAGGCGGGCTATACGGCCAAGACGG
ATCATCTGCGGCGAATGATGGAGTTGGGCCGTGGTAAGAGGACGGCTTCGAAGAATGGGCTTCTGGATTGGGTTT
CCTGTCTGGGAGGTGTCATCTGGAGGGCGGGGTTTGCCTTACAGCTGCTGTGGCATCTTGTTGCCGTCGCTCCGC
TTCTAAGAGACGGAGGCGACGGCTTGCGAGATCCGAACGAGGCAGGCCTTTCGGTTACAGCGACGGCCTGGCTTG
GAAGCGTGGCGGATGTGCTTCCTGGGCCGGATGTGCTCGTTCGCTGGACCGTGGCGGCAGCTGTTGCGTCGGTAT
GGTGGAATCCTTACTTTGTCCAGCTATTTCGGGGCTTCACGAGGCATTTGACTGGCTTCAAGCAGTGGTATTCCT
TCCAGAGCCTGATCGTCGTCTTCCGCCTTGTCTGCTGGGGCCTTGTCGGCGTCGGGGCTCAGTCACGTCAGGCAC
AGCTGAGCCTTCATATGGCCATGGCGTCTGTCATGACACTGGTAAGAAGGGAGATAGCTCCACCAATTGTCTTTG
AACCCGAACTGACAGCCTCGCAGATATACGTCTTTTCGCGCAAGTCGATGCGCGTCGACACGTCGCCCCTATTTG
GCGCCGGCTCCAGTTCCGGGCTCAAAGAAGCGGCCATGACTCCGGTCAGAAGCAAGGACGAAACTACCAAGACGT
TGTCCGACATGCTGACCGATGCCCTCGAGTCGACGCCACAAAGACAAGGGCACCGGCGGCCCCCAACAAGCATCT
CACCCAGCCCGCTGCCTGCACAGAGGCAAGCCTACAACAACTCCCTAGCCGTCTATCGCGAAACCCCCGGCCTTC
TGCCGCAGCAGCAGGCCCAGTACGCCGAGGAGATGGACTGGTCGCCCGTTACACCAGGGCATCGTGCCTTGGCCC
CCCAGCCGTCTCCGAACAAGGGCATGGGCATAGACAAGAGCCCCTTTTGGTACAAGGTCCCCGCAGCGCCGGTGA
CGCCCGCGCGACAGCTAAGGAATCCTCCGAGGGCGCCGGATGTGAAGCCGGCCATGTTGGAGACGGATAGATTCG
CCTTTTCGCCGGCGACGACGCGCGAAAAGGGGCGCGGTCAGAGCACCGCTGGGGTGGAGTTCCGGCAGCCGCAGT
TTTTCGCGCCGGAGCGGGACGACGCCAACTCGTTGGCTGATCTCCTGGGCCAGAGCTTTAGTCTGAGCCAGGACC
GTGACCAGGAGGGCGATGACGATGACGATGACGACGATAATAATGATGATGATGATGATGGAAAGGTTACGACAC
TCGGCGGTCAAGGGAAGAGTCGGAGGACGGCCACGTCGTCGGCCAGGAGGCTATCTCACGGAGGGGCAAGCACAT
GGCATCGCCGCCTCGTCGAACCCGTCGCGCTCATCGTTCTACCTATCATGTGGGCGCTGACACTGACCTCTGCCG
TGCCCTTCCGAAACGAGTGCCAGGCGGCGATCATAGCCATGTCCGGACTCATGACCTTTCTCGGCGCCGGCGAGG
AGCGGCACGGCTCCAGGTCCGAGCAGGTCCTGGCAGCATGGGCGACTGCAGAGCTGGCGGCCTCTTTTTGGGTCT
TCTATGCGCTGTCGACGGATGGAGAGGCGCCGTGGTACGGCTCGGGCGTTCTGGCTTCGACGGCGGCGCGTTTGG
CGCTGAGACGGCTCGGCATGGAACGCTGGCTTTGAGCGGCGAGGGATCCCTTTTTTCAGCCAGTTGCAGCGGACT
CTCATGAATACGAGCCCTGCTGGATGAGTTGTGAGCCGTCGAGTGAGTTGTCATTGCAGCCTTTCTACTTGATAA
GATGTGGATGGATTTAATGAATGTCTTCGTTAGCGGCCGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail