Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3844
Gene name
Locationscaffold_30:22021..23886
Strand+
Gene length (bp)1865
Transcript length (bp)1746
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01564 Spermine_synth Spermine/spermidine synthase domain 1.8E-07 339 445

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8D3Q3|SPEE_VIBVU Polyamine aminopropyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=speE PE=3 SV=1 332 446 4.0E-09
sp|Q7MF74|SPEE_VIBVY Polyamine aminopropyltransferase OS=Vibrio vulnificus (strain YJ016) GN=speE PE=3 SV=1 332 446 5.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 85 107 22
3 112 134 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 74.42 40.55 108.30
CcL In ants, during behavior modification 74.58 38.95 110.21
CcD In ants, recently dead 34.10 18.04 50.15

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.993224 no
SC16a CcD 0.000535 yes
CcL CcD 0.000770 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3844
MPGKKKTGVTAAPAEGFTPERFEAELKDLAAKARDDSSGRHVFEQLSLYAKAVSLLALLGIYSTVSPLTLSPVYG
SLPSSLWHSQLLMTGCFIGWAGNVAFRNLLLVKTIHLLPLVALYIPTAQWFLLGYSSLLGPRWGPVVTEGLTFVP
LAALTAAAVADLFEDARLSLLPGFVAEAAPGIGSWAWLKFVELLASRHLPPNMGRSIGLTRLGLELTLGALYSLF
ARSKLLLYVLPPLLHTLVVNTHFASPHATSSLVSSLLSDNWLLLERRESMTGYVSVLQSMEEGFRAMRCDHSLLG
GDWINERGRALSEPIYGVFVMLEAVRLAERDSPPPDEEARALVVGLGVGTTPSALVTHGINTTVVEIDPVVYEFA
VKYFDLKENSPPVLEDAVSYTSALAASAPQSYDYIIHDVFTGGAEPVQLFTFEFIEGLEKLLKPNGIIAVNYAGD
LALPAPTVIFRTIKRVFPTCRVFREVPPDAKAIELDGADFANMVIFCTKSNAPLTFRRPTQADHLESATRKQFLN
LDHEMLESEFLSRDEDETTILRRNDTSAVEKWHEQGALGHWAIMRRMLPASVWERW
Coding >Ophio5|3844
ATGCCGGGAAAAAAAAAGACTGGCGTGACAGCGGCGCCGGCCGAGGGCTTCACGCCCGAACGCTTCGAGGCCGAG
TTGAAGGACCTCGCGGCCAAGGCAAGGGACGATTCTTCGGGCAGGCATGTTTTCGAGCAGCTGTCCCTGTACGCC
AAGGCCGTCTCTCTGCTGGCCCTCCTCGGCATCTACTCCACCGTCTCGCCGCTCACCTTGTCGCCCGTCTACGGG
TCCCTGCCATCCTCGCTATGGCACTCCCAGCTCCTCATGACCGGCTGCTTCATCGGATGGGCGGGAAACGTGGCC
TTCAGAAACTTGCTCCTCGTCAAGACGATCCACCTGCTCCCGCTCGTCGCCCTGTATATACCGACAGCACAATGG
TTCCTTCTCGGCTATAGCAGCCTGCTCGGCCCCCGGTGGGGTCCCGTCGTCACCGAGGGCCTTACCTTCGTCCCC
CTCGCTGCCTTGACTGCCGCTGCCGTCGCCGACCTTTTCGAGGATGCGCGGCTGTCTCTGCTTCCGGGCTTCGTC
GCCGAGGCCGCACCGGGGATCGGTTCTTGGGCCTGGCTCAAGTTCGTTGAGCTGCTGGCTAGCCGCCATCTGCCG
CCCAACATGGGGCGCTCCATTGGTCTCACCCGCCTCGGCCTAGAACTGACGCTGGGTGCCTTGTACTCCCTGTTC
GCTCGTTCCAAGCTTCTTCTTTACGTGCTGCCGCCACTCCTGCATACCTTGGTCGTCAACACGCACTTCGCCTCG
CCCCACGCCACCTCCTCGCTCGTCAGCTCCCTACTGTCAGACAATTGGTTGCTGCTGGAGCGTCGAGAGTCGATG
ACGGGGTACGTTTCCGTCTTGCAGAGCATGGAGGAAGGCTTTCGCGCCATGCGCTGTGACCACAGTCTCCTGGGT
GGCGACTGGATTAACGAGCGCGGCCGCGCGCTGTCGGAGCCCATCTACGGCGTCTTCGTCATGCTCGAGGCTGTG
CGATTGGCCGAGAGGGACAGCCCGCCGCCAGACGAGGAGGCTCGTGCCTTGGTTGTTGGGCTGGGCGTGGGAACG
ACACCTTCGGCTCTCGTCACTCACGGCATCAACACGACCGTTGTTGAAATAGACCCGGTCGTGTACGAGTTTGCC
GTAAAGTACTTTGACCTCAAGGAAAATAGTCCTCCCGTATTGGAGGATGCTGTGAGCTACACCTCAGCCTTGGCG
GCCTCCGCGCCCCAAAGTTACGACTATATCATCCATGACGTCTTCACCGGCGGCGCGGAACCGGTGCAGCTCTTC
ACTTTTGAATTTATTGAAGGCCTTGAGAAGCTGCTCAAGCCCAACGGAATCATCGCCGTCAATTACGCCGGCGAT
CTTGCTCTTCCGGCCCCTACCGTCATATTCCGCACCATAAAGCGCGTCTTCCCGACATGTCGCGTCTTCCGCGAG
GTGCCGCCGGATGCCAAAGCCATCGAGTTAGACGGAGCCGACTTTGCCAACATGGTCATCTTCTGCACCAAGTCA
AATGCTCCGCTGACTTTCAGGAGGCCCACACAGGCAGACCATCTTGAGAGCGCGACGAGGAAACAGTTCCTCAAC
CTCGACCACGAGATGCTCGAGTCCGAGTTTCTGTCCCGCGATGAAGACGAGACGACCATTTTGCGGAGAAACGAT
ACCAGTGCGGTGGAGAAGTGGCACGAACAGGGCGCGCTGGGCCACTGGGCCATTATGAGGAGGATGCTCCCAGCC
TCCGTATGGGAACGGTGG
Transcript >Ophio5|3844
ATGCCGGGAAAAAAAAAGACTGGCGTGACAGCGGCGCCGGCCGAGGGCTTCACGCCCGAACGCTTCGAGGCCGAG
TTGAAGGACCTCGCGGCCAAGGCAAGGGACGATTCTTCGGGCAGGCATGTTTTCGAGCAGCTGTCCCTGTACGCC
AAGGCCGTCTCTCTGCTGGCCCTCCTCGGCATCTACTCCACCGTCTCGCCGCTCACCTTGTCGCCCGTCTACGGG
TCCCTGCCATCCTCGCTATGGCACTCCCAGCTCCTCATGACCGGCTGCTTCATCGGATGGGCGGGAAACGTGGCC
TTCAGAAACTTGCTCCTCGTCAAGACGATCCACCTGCTCCCGCTCGTCGCCCTGTATATACCGACAGCACAATGG
TTCCTTCTCGGCTATAGCAGCCTGCTCGGCCCCCGGTGGGGTCCCGTCGTCACCGAGGGCCTTACCTTCGTCCCC
CTCGCTGCCTTGACTGCCGCTGCCGTCGCCGACCTTTTCGAGGATGCGCGGCTGTCTCTGCTTCCGGGCTTCGTC
GCCGAGGCCGCACCGGGGATCGGTTCTTGGGCCTGGCTCAAGTTCGTTGAGCTGCTGGCTAGCCGCCATCTGCCG
CCCAACATGGGGCGCTCCATTGGTCTCACCCGCCTCGGCCTAGAACTGACGCTGGGTGCCTTGTACTCCCTGTTC
GCTCGTTCCAAGCTTCTTCTTTACGTGCTGCCGCCACTCCTGCATACCTTGGTCGTCAACACGCACTTCGCCTCG
CCCCACGCCACCTCCTCGCTCGTCAGCTCCCTACTGTCAGACAATTGGTTGCTGCTGGAGCGTCGAGAGTCGATG
ACGGGGTACGTTTCCGTCTTGCAGAGCATGGAGGAAGGCTTTCGCGCCATGCGCTGTGACCACAGTCTCCTGGGT
GGCGACTGGATTAACGAGCGCGGCCGCGCGCTGTCGGAGCCCATCTACGGCGTCTTCGTCATGCTCGAGGCTGTG
CGATTGGCCGAGAGGGACAGCCCGCCGCCAGACGAGGAGGCTCGTGCCTTGGTTGTTGGGCTGGGCGTGGGAACG
ACACCTTCGGCTCTCGTCACTCACGGCATCAACACGACCGTTGTTGAAATAGACCCGGTCGTGTACGAGTTTGCC
GTAAAGTACTTTGACCTCAAGGAAAATAGTCCTCCCGTATTGGAGGATGCTGTGAGCTACACCTCAGCCTTGGCG
GCCTCCGCGCCCCAAAGTTACGACTATATCATCCATGACGTCTTCACCGGCGGCGCGGAACCGGTGCAGCTCTTC
ACTTTTGAATTTATTGAAGGCCTTGAGAAGCTGCTCAAGCCCAACGGAATCATCGCCGTCAATTACGCCGGCGAT
CTTGCTCTTCCGGCCCCTACCGTCATATTCCGCACCATAAAGCGCGTCTTCCCGACATGTCGCGTCTTCCGCGAG
GTGCCGCCGGATGCCAAAGCCATCGAGTTAGACGGAGCCGACTTTGCCAACATGGTCATCTTCTGCACCAAGTCA
AATGCTCCGCTGACTTTCAGGAGGCCCACACAGGCAGACCATCTTGAGAGCGCGACGAGGAAACAGTTCCTCAAC
CTCGACCACGAGATGCTCGAGTCCGAGTTTCTGTCCCGCGATGAAGACGAGACGACCATTTTGCGGAGAAACGAT
ACCAGTGCGGTGGAGAAGTGGCACGAACAGGGCGCGCTGGGCCACTGGGCCATTATGAGGAGGATGCTCCCAGCC
TCCGTATGGGAACGGTGGTGA
Gene >Ophio5|3844
ATGCCGGGAAAAAAAAAGACTGGCGTGACAGCGGCGCCGGCCGAGGGCTTCACGCCCGAACGCTTCGAGGCCGAG
TTGAAGGACCTCGCGGCCAAGGCAAGGGACGATTCTTCGGGCAGGCATGTTTTCGAGCAGCTGTCCCTGTACGCC
AAGGCCGTCTCTCTGCTGGCCCTCCTCGGCATCTACTCCACCGTCTCGCCGCTCACCTTGTCGCCCGTCTACGGG
TCCCTGCCATCCTCGCTATGGCACTCCCAGCTCCTCATGACCGGCTGCTTCATCGGATGGGCGGGAAACGTGGCC
TTCAGAAACTTGCTCCTCGTCAAGACGATCCACCTGCTCCCGCTCGTCGCCCTGTATATACCGACAGCACAATGG
TTCCTTCTCGGCTATAGCAGCCTGCTCGGCCCCCGGTGGGGTCCCGTCGTCACCGAGGGCCTTACCTTCGTCCCC
CTCGCTGCCTTGACTGCCGCTGCCGTCGCCGACCTTTTCGAGGATGCGCGGCTGTCTCTGCTTCCGGGCTTCGTC
GCCGAGGCCGCACCGGGGATCGGTTCTTGGGCCTGGCTCAAGTTCGTTGAGCTGCTGGCTAGCCGCCATCTGCCG
CCCAACATGGGGCGCTCCATTGGTCTCACCCGCCTCGGCCTAGAACTGACGCTGGGTGCCTTGTACTCCCTGTTC
GCTCGTTCCAAGCTTCTTCTTTACGTGCTGCCGCCACTCCTGCATACCTTGGTCGTCAACACGCACTTCGCCTCG
CCCCACGCCACCTCCTCGCTCGTCAGCTCCCTACTGTCAGACAATTGGTTGCTGCTGGAGCGTCGAGAGTCGATG
ACGGGGTACGTTTCCGTCTTGCAGAGCATGGAGGAAGGCTTTCGCGCCATGCGCTGTGACCACAGTCTCCTGGGT
GGCGACTGGATTAACGAGCGCGGCCGCGCGCTGTCGGAGCCCATCTACGGCGTCTTCGTCATGCTCGAGGCTGTG
CGATTGGCCGAGAGGGACAGCCCGCCGCCAGACGAGGAGGCTCGTGCCTTGGTTGTGTAAGTTGCCGGCCACAAC
TCGGCCCTGTTTCTATCGGCGCTGACGAGACGCAGTGGGCTGGGCGTGGGAACGACACCTTCGGCTCTCGTCACT
CACGGCATCAACACGACCGTTGTTGAAATAGACCCGGTCGTGTACGAGTTTGCCGTAAAGTACTTTGACCTCAAG
GAAAATAGTCCTCCCGTATTGGAGGATGCTGTGAGCTACACCTCAGCCTTGGCGGCCTCCGCGCCCCAAAGTTAC
GACTATATCATCCATGACGTCTTCACCGGCGGCGCGGAACCGGTGCAGCTCTTCACTTTTGAATTTATTGAAGGC
CTTGAGAAGCTGCTCAAGCCCAACGGAATCATCGCCGTCGTGAGTGGCTACCGACAGTCAAGTTTCCGAGTGTTC
AGGGGCCCGAATCTAATTTTTCTTTTCAGAATTACGCCGGCGATCTTGCTCTTCCGGCCCCTACCGTCATATTCC
GCACCATAAAGCGCGTCTTCCCGACATGTCGCGTCTTCCGCGAGGTGCCGCCGGATGCCAAAGCCATCGAGTTAG
ACGGAGCCGACTTTGCCAACATGGTCATCTTCTGCACCAAGTCAAATGCTCCGCTGACTTTCAGGAGGCCCACAC
AGGCAGACCATCTTGAGAGCGCGACGAGGAAACAGTTCCTCAACCTCGACCACGAGATGCTCGAGTCCGAGTTTC
TGTCCCGCGATGAAGACGAGACGACCATTTTGCGGAGAAACGATACCAGTGCGGTGGAGAAGTGGCACGAACAGG
GCGCGCTGGGCCACTGGGCCATTATGAGGAGGATGCTCCCAGCCTCCGTATGGGAACGGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail