Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3844
Gene name
Locationscaffold_30:22021..23886
Strand+
Gene length (bp)1865
Transcript length (bp)1746
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01564 Spermine_synth Spermine/spermidine synthase domain 1.8E-07 339 445

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8D3Q3|SPEE_VIBVU Polyamine aminopropyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=speE PE=3 SV=1 332 446 4.0E-09
sp|Q7MF74|SPEE_VIBVY Polyamine aminopropyltransferase OS=Vibrio vulnificus (strain YJ016) GN=speE PE=3 SV=1 332 446 5.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 85 107 22
3 112 134 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3844
MPGKKKTGVTAAPAEGFTPERFEAELKDLAAKARDDSSGRHVFEQLSLYAKAVSLLALLGIYSTVSPLTLSPVYG
SLPSSLWHSQLLMTGCFIGWAGNVAFRNLLLVKTIHLLPLVALYIPTAQWFLLGYSSLLGPRWGPVVTEGLTFVP
LAALTAAAVADLFEDARLSLLPGFVAEAAPGIGSWAWLKFVELLASRHLPPNMGRSIGLTRLGLELTLGALYSLF
ARSKLLLYVLPPLLHTLVVNTHFASPHATSSLVSSLLSDNWLLLERRESMTGYVSVLQSMEEGFRAMRCDHSLLG
GDWINERGRALSEPIYGVFVMLEAVRLAERDSPPPDEEARALVVGLGVGTTPSALVTHGINTTVVEIDPVVYEFA
VKYFDLKENSPPVLEDAVSYTSALAASAPQSYDYIIHDVFTGGAEPVQLFTFEFIEGLEKLLKPNGIIAVNYAGD
LALPAPTVIFRTIKRVFPTCRVFREVPPDAKAIELDGADFANMVIFCTKSNAPLTFRRPTQADHLESATRKQFLN
LDHEMLESEFLSRDEDETTILRRNDTSAVEKWHEQGALGHWAIMRRMLPASVWERW
Coding >Ophio5|3844
ATGCCGGGAAAAAAAAAGACTGGCGTGACAGCGGCGCCGGCCGAGGGCTTCACGCCCGAACGCTTCGAGGCCGAG
TTGAAGGACCTCGCGGCCAAGGCAAGGGACGATTCTTCGGGCAGGCATGTTTTCGAGCAGCTGTCCCTGTACGCC
AAGGCCGTCTCTCTGCTGGCCCTCCTCGGCATCTACTCCACCGTCTCGCCGCTCACCTTGTCGCCCGTCTACGGG
TCCCTGCCATCCTCGCTATGGCACTCCCAGCTCCTCATGACCGGCTGCTTCATCGGATGGGCGGGAAACGTGGCC
TTCAGAAACTTGCTCCTCGTCAAGACGATCCACCTGCTCCCGCTCGTCGCCCTGTATATACCGACAGCACAATGG
TTCCTTCTCGGCTATAGCAGCCTGCTCGGCCCCCGGTGGGGTCCCGTCGTCACCGAGGGCCTTACCTTCGTCCCC
CTCGCTGCCTTGACTGCCGCTGCCGTCGCCGACCTTTTCGAGGATGCGCGGCTGTCTCTGCTTCCGGGCTTCGTC
GCCGAGGCCGCACCGGGGATCGGTTCTTGGGCCTGGCTCAAGTTCGTTGAGCTGCTGGCTAGCCGCCATCTGCCG
CCCAACATGGGGCGCTCCATTGGTCTCACCCGCCTCGGCCTAGAACTGACGCTGGGTGCCTTGTACTCCCTGTTC
GCTCGTTCCAAGCTTCTTCTTTACGTGCTGCCGCCACTCCTGCATACCTTGGTCGTCAACACGCACTTCGCCTCG
CCCCACGCCACCTCCTCGCTCGTCAGCTCCCTACTGTCAGACAATTGGTTGCTGCTGGAGCGTCGAGAGTCGATG
ACGGGGTACGTTTCCGTCTTGCAGAGCATGGAGGAAGGCTTTCGCGCCATGCGCTGTGACCACAGTCTCCTGGGT
GGCGACTGGATTAACGAGCGCGGCCGCGCGCTGTCGGAGCCCATCTACGGCGTCTTCGTCATGCTCGAGGCTGTG
CGATTGGCCGAGAGGGACAGCCCGCCGCCAGACGAGGAGGCTCGTGCCTTGGTTGTTGGGCTGGGCGTGGGAACG
ACACCTTCGGCTCTCGTCACTCACGGCATCAACACGACCGTTGTTGAAATAGACCCGGTCGTGTACGAGTTTGCC
GTAAAGTACTTTGACCTCAAGGAAAATAGTCCTCCCGTATTGGAGGATGCTGTGAGCTACACCTCAGCCTTGGCG
GCCTCCGCGCCCCAAAGTTACGACTATATCATCCATGACGTCTTCACCGGCGGCGCGGAACCGGTGCAGCTCTTC
ACTTTTGAATTTATTGAAGGCCTTGAGAAGCTGCTCAAGCCCAACGGAATCATCGCCGTCAATTACGCCGGCGAT
CTTGCTCTTCCGGCCCCTACCGTCATATTCCGCACCATAAAGCGCGTCTTCCCGACATGTCGCGTCTTCCGCGAG
GTGCCGCCGGATGCCAAAGCCATCGAGTTAGACGGAGCCGACTTTGCCAACATGGTCATCTTCTGCACCAAGTCA
AATGCTCCGCTGACTTTCAGGAGGCCCACACAGGCAGACCATCTTGAGAGCGCGACGAGGAAACAGTTCCTCAAC
CTCGACCACGAGATGCTCGAGTCCGAGTTTCTGTCCCGCGATGAAGACGAGACGACCATTTTGCGGAGAAACGAT
ACCAGTGCGGTGGAGAAGTGGCACGAACAGGGCGCGCTGGGCCACTGGGCCATTATGAGGAGGATGCTCCCAGCC
TCCGTATGGGAACGGTGG
Transcript >Ophio5|3844
ATGCCGGGAAAAAAAAAGACTGGCGTGACAGCGGCGCCGGCCGAGGGCTTCACGCCCGAACGCTTCGAGGCCGAG
TTGAAGGACCTCGCGGCCAAGGCAAGGGACGATTCTTCGGGCAGGCATGTTTTCGAGCAGCTGTCCCTGTACGCC
AAGGCCGTCTCTCTGCTGGCCCTCCTCGGCATCTACTCCACCGTCTCGCCGCTCACCTTGTCGCCCGTCTACGGG
TCCCTGCCATCCTCGCTATGGCACTCCCAGCTCCTCATGACCGGCTGCTTCATCGGATGGGCGGGAAACGTGGCC
TTCAGAAACTTGCTCCTCGTCAAGACGATCCACCTGCTCCCGCTCGTCGCCCTGTATATACCGACAGCACAATGG
TTCCTTCTCGGCTATAGCAGCCTGCTCGGCCCCCGGTGGGGTCCCGTCGTCACCGAGGGCCTTACCTTCGTCCCC
CTCGCTGCCTTGACTGCCGCTGCCGTCGCCGACCTTTTCGAGGATGCGCGGCTGTCTCTGCTTCCGGGCTTCGTC
GCCGAGGCCGCACCGGGGATCGGTTCTTGGGCCTGGCTCAAGTTCGTTGAGCTGCTGGCTAGCCGCCATCTGCCG
CCCAACATGGGGCGCTCCATTGGTCTCACCCGCCTCGGCCTAGAACTGACGCTGGGTGCCTTGTACTCCCTGTTC
GCTCGTTCCAAGCTTCTTCTTTACGTGCTGCCGCCACTCCTGCATACCTTGGTCGTCAACACGCACTTCGCCTCG
CCCCACGCCACCTCCTCGCTCGTCAGCTCCCTACTGTCAGACAATTGGTTGCTGCTGGAGCGTCGAGAGTCGATG
ACGGGGTACGTTTCCGTCTTGCAGAGCATGGAGGAAGGCTTTCGCGCCATGCGCTGTGACCACAGTCTCCTGGGT
GGCGACTGGATTAACGAGCGCGGCCGCGCGCTGTCGGAGCCCATCTACGGCGTCTTCGTCATGCTCGAGGCTGTG
CGATTGGCCGAGAGGGACAGCCCGCCGCCAGACGAGGAGGCTCGTGCCTTGGTTGTTGGGCTGGGCGTGGGAACG
ACACCTTCGGCTCTCGTCACTCACGGCATCAACACGACCGTTGTTGAAATAGACCCGGTCGTGTACGAGTTTGCC
GTAAAGTACTTTGACCTCAAGGAAAATAGTCCTCCCGTATTGGAGGATGCTGTGAGCTACACCTCAGCCTTGGCG
GCCTCCGCGCCCCAAAGTTACGACTATATCATCCATGACGTCTTCACCGGCGGCGCGGAACCGGTGCAGCTCTTC
ACTTTTGAATTTATTGAAGGCCTTGAGAAGCTGCTCAAGCCCAACGGAATCATCGCCGTCAATTACGCCGGCGAT
CTTGCTCTTCCGGCCCCTACCGTCATATTCCGCACCATAAAGCGCGTCTTCCCGACATGTCGCGTCTTCCGCGAG
GTGCCGCCGGATGCCAAAGCCATCGAGTTAGACGGAGCCGACTTTGCCAACATGGTCATCTTCTGCACCAAGTCA
AATGCTCCGCTGACTTTCAGGAGGCCCACACAGGCAGACCATCTTGAGAGCGCGACGAGGAAACAGTTCCTCAAC
CTCGACCACGAGATGCTCGAGTCCGAGTTTCTGTCCCGCGATGAAGACGAGACGACCATTTTGCGGAGAAACGAT
ACCAGTGCGGTGGAGAAGTGGCACGAACAGGGCGCGCTGGGCCACTGGGCCATTATGAGGAGGATGCTCCCAGCC
TCCGTATGGGAACGGTGGTGA
Gene >Ophio5|3844
ATGCCGGGAAAAAAAAAGACTGGCGTGACAGCGGCGCCGGCCGAGGGCTTCACGCCCGAACGCTTCGAGGCCGAG
TTGAAGGACCTCGCGGCCAAGGCAAGGGACGATTCTTCGGGCAGGCATGTTTTCGAGCAGCTGTCCCTGTACGCC
AAGGCCGTCTCTCTGCTGGCCCTCCTCGGCATCTACTCCACCGTCTCGCCGCTCACCTTGTCGCCCGTCTACGGG
TCCCTGCCATCCTCGCTATGGCACTCCCAGCTCCTCATGACCGGCTGCTTCATCGGATGGGCGGGAAACGTGGCC
TTCAGAAACTTGCTCCTCGTCAAGACGATCCACCTGCTCCCGCTCGTCGCCCTGTATATACCGACAGCACAATGG
TTCCTTCTCGGCTATAGCAGCCTGCTCGGCCCCCGGTGGGGTCCCGTCGTCACCGAGGGCCTTACCTTCGTCCCC
CTCGCTGCCTTGACTGCCGCTGCCGTCGCCGACCTTTTCGAGGATGCGCGGCTGTCTCTGCTTCCGGGCTTCGTC
GCCGAGGCCGCACCGGGGATCGGTTCTTGGGCCTGGCTCAAGTTCGTTGAGCTGCTGGCTAGCCGCCATCTGCCG
CCCAACATGGGGCGCTCCATTGGTCTCACCCGCCTCGGCCTAGAACTGACGCTGGGTGCCTTGTACTCCCTGTTC
GCTCGTTCCAAGCTTCTTCTTTACGTGCTGCCGCCACTCCTGCATACCTTGGTCGTCAACACGCACTTCGCCTCG
CCCCACGCCACCTCCTCGCTCGTCAGCTCCCTACTGTCAGACAATTGGTTGCTGCTGGAGCGTCGAGAGTCGATG
ACGGGGTACGTTTCCGTCTTGCAGAGCATGGAGGAAGGCTTTCGCGCCATGCGCTGTGACCACAGTCTCCTGGGT
GGCGACTGGATTAACGAGCGCGGCCGCGCGCTGTCGGAGCCCATCTACGGCGTCTTCGTCATGCTCGAGGCTGTG
CGATTGGCCGAGAGGGACAGCCCGCCGCCAGACGAGGAGGCTCGTGCCTTGGTTGTGTAAGTTGCCGGCCACAAC
TCGGCCCTGTTTCTATCGGCGCTGACGAGACGCAGTGGGCTGGGCGTGGGAACGACACCTTCGGCTCTCGTCACT
CACGGCATCAACACGACCGTTGTTGAAATAGACCCGGTCGTGTACGAGTTTGCCGTAAAGTACTTTGACCTCAAG
GAAAATAGTCCTCCCGTATTGGAGGATGCTGTGAGCTACACCTCAGCCTTGGCGGCCTCCGCGCCCCAAAGTTAC
GACTATATCATCCATGACGTCTTCACCGGCGGCGCGGAACCGGTGCAGCTCTTCACTTTTGAATTTATTGAAGGC
CTTGAGAAGCTGCTCAAGCCCAACGGAATCATCGCCGTCGTGAGTGGCTACCGACAGTCAAGTTTCCGAGTGTTC
AGGGGCCCGAATCTAATTTTTCTTTTCAGAATTACGCCGGCGATCTTGCTCTTCCGGCCCCTACCGTCATATTCC
GCACCATAAAGCGCGTCTTCCCGACATGTCGCGTCTTCCGCGAGGTGCCGCCGGATGCCAAAGCCATCGAGTTAG
ACGGAGCCGACTTTGCCAACATGGTCATCTTCTGCACCAAGTCAAATGCTCCGCTGACTTTCAGGAGGCCCACAC
AGGCAGACCATCTTGAGAGCGCGACGAGGAAACAGTTCCTCAACCTCGACCACGAGATGCTCGAGTCCGAGTTTC
TGTCCCGCGATGAAGACGAGACGACCATTTTGCGGAGAAACGATACCAGTGCGGTGGAGAAGTGGCACGAACAGG
GCGCGCTGGGCCACTGGGCCATTATGAGGAGGATGCTCCCAGCCTCCGTATGGGAACGGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail