Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3843
Gene name
Locationscaffold_30:18632..21507
Strand+
Gene length (bp)2875
Transcript length (bp)2436
Coding sequence length (bp)2433
Protein length (aa) 811

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 1.2E-15 261 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P21657|DAL81_YEAST Transcriptional activator protein DAL81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL81 PE=1 SV=3 181 645 1.0E-99
sp|Q9UTA7|YL8B_SCHPO Uncharacterized transcriptional regulatory protein C25B8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.11 PE=3 SV=1 257 499 2.0E-29
sp|Q9P7H9|YIT3_SCHPO Uncharacterized transcriptional regulatory protein C105.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC105.03c PE=3 SV=1 186 480 9.0E-29
sp|Q06157|AMDR_ASPOR Acetamidase regulatory protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amdR PE=2 SV=2 209 636 2.0E-10
sp|Q4WK35|AMDR_ASPFU Acetamidase regulatory protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=amdR PE=3 SV=1 209 609 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P21657|DAL81_YEAST Transcriptional activator protein DAL81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL81 PE=1 SV=3 181 645 1.0E-99
sp|Q9UTA7|YL8B_SCHPO Uncharacterized transcriptional regulatory protein C25B8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.11 PE=3 SV=1 257 499 2.0E-29
sp|Q9P7H9|YIT3_SCHPO Uncharacterized transcriptional regulatory protein C105.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC105.03c PE=3 SV=1 186 480 9.0E-29
sp|Q06157|AMDR_ASPOR Acetamidase regulatory protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amdR PE=2 SV=2 209 636 2.0E-10
sp|Q4WK35|AMDR_ASPFU Acetamidase regulatory protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=amdR PE=3 SV=1 209 609 4.0E-10
sp|P15699|AMDR_EMENI Acetamidase regulatory protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=amdR PE=3 SV=2 195 430 2.0E-07
sp|P52958|CTF1A_FUSSO Cutinase transcription factor 1 alpha OS=Fusarium solani subsp. pisi GN=CTF1-ALPHA PE=2 SV=1 260 550 4.0E-07
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 261 555 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009059 macromolecule biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3843
MSLPTYAPPPSRPLRMAQGTSVQRTAPIAIAPKPARLGPSPSSPFRLDGALRRVLDLDVLASEPSSLPTSPSRPY
RFSGAPMVEDDDDGDNDGDGDDDDDDDDDDDDDDNNDDEPPPAHCCEAAASPHSRKRKLNGGHGPTDAGLGKKSS
PGMPHNSSASSAAASSSLLDGPAMLRRTLGLQSDRYSQYIGPTTDFEPSLINLSAFDPHDESLLSRGVLRKVSDD
DTFLMLADRATPGFDRIVRDADAIEAVVAPHGRALIDLYFDVVHPAFPIVQKHVLLQKYDNSHRDLSPPILAAVY
ILAINWWEQCEALAALPRPDVRELERLVRSTLQDALNRPRLSTIQAGLLLSQRPEGDQWAPTAQLVAVGQELGLH
LDCSGWKIPPWEKGLRRRLAWALYMQDKWGALVHGRPSHILAANWAVRPVSAQDFPDADSEEADPDGRRRIESGR
LLFTRAIQLSEILAEILETFYTLQSARTIADAGSQATQLVLSMAKPVQLKLKEWYAGLPAALRLDAYSAGSPPVT
QTGRRLSSIGHLHLAYFATEITLHRRIIRSLASDPASVDPYVQHICRGAAKARLISAMDFVNRLTPGHLRSFWYF
ASKTNFALIGTFGSLLWATSPGREEADWYRRRLAEYRWTLSVSSKPGEGRGLTEFAMSMLDISTGLLKQLPEKPS
MSRSTSFVDLSVPVGPSPFGPTLSGPTRRGAGGVAFLHRLATAPGSDLHDTGVKKRFEAFPVKEARRFRERQADG
SRRSTRQEISNTWRKPRHLGMDCVFRGDDGSVKTISSLGGGLDSDWASLSAVNAAATEVRR
Coding >Ophio5|3843
ATGTCTCTGCCAACGTACGCTCCTCCGCCATCACGCCCACTCCGTATGGCCCAGGGCACGTCCGTTCAGCGCACG
GCGCCCATCGCCATCGCGCCCAAGCCCGCTCGTTTGGGCCCTTCACCGTCGTCGCCCTTTCGCCTGGACGGCGCC
CTGAGACGCGTCTTGGACTTGGATGTCCTCGCCTCTGAGCCGTCGTCGTTGCCCACGTCGCCGAGCCGACCATAT
CGCTTCTCGGGCGCGCCCATGGTAGAGGATGATGACGATGGCGACAACGACGGCGACGGCGACGACGACGACGAC
GACGACGACGATGACGACGACGACGACAACAACGACGATGAGCCGCCACCTGCACATTGTTGTGAAGCCGCTGCC
AGCCCGCACTCCCGCAAGAGGAAGCTCAACGGTGGTCACGGTCCGACCGACGCTGGCCTCGGCAAGAAAAGCTCG
CCCGGCATGCCGCACAACTCCAGCGCTTCCAGCGCCGCCGCCAGCAGCTCCCTTCTCGACGGGCCCGCCATGCTC
CGGCGCACACTGGGCCTCCAGAGCGACCGCTACAGCCAGTACATCGGCCCGACCACCGATTTCGAACCATCCCTC
ATCAATCTCTCGGCCTTCGACCCCCACGACGAGAGCCTCCTTTCCCGCGGTGTTCTTCGCAAAGTCAGCGACGAT
GACACCTTTCTCATGCTCGCCGACCGCGCCACGCCCGGCTTCGACCGCATCGTCCGTGATGCCGACGCCATCGAG
GCCGTCGTCGCCCCCCACGGCCGCGCCCTCATCGACCTCTATTTCGACGTCGTCCATCCGGCCTTTCCGATAGTC
CAGAAGCACGTCTTGTTGCAAAAGTATGACAACTCGCACCGCGACCTGTCGCCTCCGATCCTGGCCGCCGTCTAT
ATCCTGGCCATCAACTGGTGGGAGCAGTGCGAGGCCCTGGCAGCTCTGCCCCGACCTGATGTGCGCGAGCTCGAG
CGGCTGGTCCGCAGCACGCTGCAGGACGCCTTGAACCGACCCCGGCTGTCCACCATTCAGGCCGGTCTGTTGCTG
TCGCAGCGGCCCGAGGGCGACCAGTGGGCGCCTACCGCTCAGCTCGTCGCCGTCGGCCAGGAGCTTGGGCTGCAC
CTCGACTGCTCCGGCTGGAAGATTCCCCCCTGGGAAAAGGGTCTGCGGAGACGACTCGCCTGGGCCCTGTATATG
CAGGACAAATGGGGTGCTCTGGTCCACGGCCGCCCGTCGCACATCTTGGCCGCCAACTGGGCCGTCCGCCCCGTC
TCAGCTCAAGACTTTCCCGACGCCGACTCGGAAGAGGCTGACCCGGACGGCCGCCGCAGAATTGAGAGTGGTCGC
CTGCTCTTCACCCGCGCCATCCAGCTGTCCGAGATCCTGGCCGAGATCCTCGAGACCTTTTACACGCTGCAGTCG
GCTCGTACCATTGCCGATGCCGGCTCGCAGGCCACCCAGCTGGTGCTGTCCATGGCGAAGCCGGTCCAGCTGAAG
CTCAAGGAGTGGTACGCCGGCCTCCCCGCTGCCCTGCGACTCGACGCCTACTCGGCCGGCAGTCCGCCGGTGACG
CAGACGGGGCGGCGGCTGTCGAGCATCGGCCACCTCCACCTGGCCTACTTCGCTACGGAAATCACACTCCACCGG
CGCATCATCCGGTCGCTGGCGTCCGACCCGGCGTCGGTCGATCCTTACGTCCAGCACATCTGCCGCGGCGCCGCC
AAGGCCCGGCTCATCTCCGCCATGGACTTTGTCAACCGCCTGACGCCTGGCCACCTCCGATCCTTTTGGTACTTT
GCCTCCAAGACCAACTTTGCCTTGATCGGCACCTTTGGCTCCCTGCTGTGGGCCACGTCCCCGGGCCGCGAGGAG
GCCGACTGGTACCGGCGACGGCTGGCCGAGTACCGCTGGACGCTGTCTGTCAGCTCCAAGCCGGGCGAGGGCCGG
GGCCTCACCGAATTCGCCATGTCGATGCTGGACATATCGACTGGCCTCCTGAAGCAGCTTCCGGAGAAACCATCG
ATGAGCCGCAGCACCAGCTTCGTCGATCTGTCGGTCCCTGTTGGTCCCTCGCCCTTCGGCCCCACCCTCTCCGGC
CCCACGCGGCGTGGAGCCGGCGGAGTGGCCTTTCTGCACCGTTTGGCCACTGCGCCCGGTTCCGACCTACACGAC
ACCGGCGTGAAGAAGCGGTTCGAGGCTTTCCCGGTCAAGGAGGCAAGGCGCTTCAGAGAAAGACAGGCGGATGGA
AGCAGGCGATCCACAAGACAAGAAATCTCGAACACATGGAGGAAGCCGAGGCATCTCGGAATGGACTGTGTATTC
CGAGGCGATGACGGCAGTGTCAAAACGATTTCCTCTTTAGGTGGTGGTCTCGACAGCGATTGGGCGTCTTTGTCC
GCCGTGAATGCCGCTGCGACTGAGGTTCGACGA
Transcript >Ophio5|3843
ATGTCTCTGCCAACGTACGCTCCTCCGCCATCACGCCCACTCCGTATGGCCCAGGGCACGTCCGTTCAGCGCACG
GCGCCCATCGCCATCGCGCCCAAGCCCGCTCGTTTGGGCCCTTCACCGTCGTCGCCCTTTCGCCTGGACGGCGCC
CTGAGACGCGTCTTGGACTTGGATGTCCTCGCCTCTGAGCCGTCGTCGTTGCCCACGTCGCCGAGCCGACCATAT
CGCTTCTCGGGCGCGCCCATGGTAGAGGATGATGACGATGGCGACAACGACGGCGACGGCGACGACGACGACGAC
GACGACGACGATGACGACGACGACGACAACAACGACGATGAGCCGCCACCTGCACATTGTTGTGAAGCCGCTGCC
AGCCCGCACTCCCGCAAGAGGAAGCTCAACGGTGGTCACGGTCCGACCGACGCTGGCCTCGGCAAGAAAAGCTCG
CCCGGCATGCCGCACAACTCCAGCGCTTCCAGCGCCGCCGCCAGCAGCTCCCTTCTCGACGGGCCCGCCATGCTC
CGGCGCACACTGGGCCTCCAGAGCGACCGCTACAGCCAGTACATCGGCCCGACCACCGATTTCGAACCATCCCTC
ATCAATCTCTCGGCCTTCGACCCCCACGACGAGAGCCTCCTTTCCCGCGGTGTTCTTCGCAAAGTCAGCGACGAT
GACACCTTTCTCATGCTCGCCGACCGCGCCACGCCCGGCTTCGACCGCATCGTCCGTGATGCCGACGCCATCGAG
GCCGTCGTCGCCCCCCACGGCCGCGCCCTCATCGACCTCTATTTCGACGTCGTCCATCCGGCCTTTCCGATAGTC
CAGAAGCACGTCTTGTTGCAAAAGTATGACAACTCGCACCGCGACCTGTCGCCTCCGATCCTGGCCGCCGTCTAT
ATCCTGGCCATCAACTGGTGGGAGCAGTGCGAGGCCCTGGCAGCTCTGCCCCGACCTGATGTGCGCGAGCTCGAG
CGGCTGGTCCGCAGCACGCTGCAGGACGCCTTGAACCGACCCCGGCTGTCCACCATTCAGGCCGGTCTGTTGCTG
TCGCAGCGGCCCGAGGGCGACCAGTGGGCGCCTACCGCTCAGCTCGTCGCCGTCGGCCAGGAGCTTGGGCTGCAC
CTCGACTGCTCCGGCTGGAAGATTCCCCCCTGGGAAAAGGGTCTGCGGAGACGACTCGCCTGGGCCCTGTATATG
CAGGACAAATGGGGTGCTCTGGTCCACGGCCGCCCGTCGCACATCTTGGCCGCCAACTGGGCCGTCCGCCCCGTC
TCAGCTCAAGACTTTCCCGACGCCGACTCGGAAGAGGCTGACCCGGACGGCCGCCGCAGAATTGAGAGTGGTCGC
CTGCTCTTCACCCGCGCCATCCAGCTGTCCGAGATCCTGGCCGAGATCCTCGAGACCTTTTACACGCTGCAGTCG
GCTCGTACCATTGCCGATGCCGGCTCGCAGGCCACCCAGCTGGTGCTGTCCATGGCGAAGCCGGTCCAGCTGAAG
CTCAAGGAGTGGTACGCCGGCCTCCCCGCTGCCCTGCGACTCGACGCCTACTCGGCCGGCAGTCCGCCGGTGACG
CAGACGGGGCGGCGGCTGTCGAGCATCGGCCACCTCCACCTGGCCTACTTCGCTACGGAAATCACACTCCACCGG
CGCATCATCCGGTCGCTGGCGTCCGACCCGGCGTCGGTCGATCCTTACGTCCAGCACATCTGCCGCGGCGCCGCC
AAGGCCCGGCTCATCTCCGCCATGGACTTTGTCAACCGCCTGACGCCTGGCCACCTCCGATCCTTTTGGTACTTT
GCCTCCAAGACCAACTTTGCCTTGATCGGCACCTTTGGCTCCCTGCTGTGGGCCACGTCCCCGGGCCGCGAGGAG
GCCGACTGGTACCGGCGACGGCTGGCCGAGTACCGCTGGACGCTGTCTGTCAGCTCCAAGCCGGGCGAGGGCCGG
GGCCTCACCGAATTCGCCATGTCGATGCTGGACATATCGACTGGCCTCCTGAAGCAGCTTCCGGAGAAACCATCG
ATGAGCCGCAGCACCAGCTTCGTCGATCTGTCGGTCCCTGTTGGTCCCTCGCCCTTCGGCCCCACCCTCTCCGGC
CCCACGCGGCGTGGAGCCGGCGGAGTGGCCTTTCTGCACCGTTTGGCCACTGCGCCCGGTTCCGACCTACACGAC
ACCGGCGTGAAGAAGCGGTTCGAGGCTTTCCCGGTCAAGGAGGCAAGGCGCTTCAGAGAAAGACAGGCGGATGGA
AGCAGGCGATCCACAAGACAAGAAATCTCGAACACATGGAGGAAGCCGAGGCATCTCGGAATGGACTGTGTATTC
CGAGGCGATGACGGCAGTGTCAAAACGATTTCCTCTTTAGGTGGTGGTCTCGACAGCGATTGGGCGTCTTTGTCC
GCCGTGAATGCCGCTGCGACTGAGGTTCGACGATAG
Gene >Ophio5|3843
ATGTCTCTGCCAACGTACGCTCCTCCGCCATCACGCCCACTCCGTATGGCCCAGGGCACGTCCGTTCAGCGCACG
GCGCCCATCGCCATCGCGCCCAAGCCCGCTCGTTTGGGCCCTTCACCGTCGTCGCCCTTTCGCCTGGACGGCGCC
CTGAGACGCGTCTTGGACTTGGATGTCCTCGCCTCTGAGCCGTCGTCGTTGCCCACGTCGCCGAGCCGACCATAT
CGCTTCTCGGGCGCGCCCATGGTAGAGGATGATGACGATGGCGACAACGACGGCGACGGCGACGACGACGACGAC
GACGACGACGATGACGACGACGACGACAACAACGACGATGAGCCGCCACCTGCACATTGTTGTGAAGCCGCTGCC
AGCCCGCACTCCCGCAAGAGGAAGCTCAACGGTGGTCACGGTCCGACCGACGCTGGCCTCGGCAAGAAAAGGTGG
GTTTTCCCCGGGCCTCCCGGAAGCGAGCCCCGGCCCCGGACCCCCGCTAATCTCGGCCTCTCTCCGGCCGCAGCT
CGCCCGGCATGCCGCACAACTCCAGCGCTTCCAGCGCCGCCGCCAGCAGCTCCCTTCTCGACGGGCCCGCCATGC
TCCGGCGCACACTGGGCCTCCAGAGCGACCGCTACAGCCAGTACATCGGCCCGACCACCGATTTCGAACCATCCC
TCATCAATCTCTCGGCCTTCGACCCCCACGACGAGAGCCTCCTTTCCCGCGGTGTTCTTCGCAAAGTCAGCGACG
ATGACACCTTTCTCATGCTCGCCGACCGCGCCACGCCCGGCTTCGACCGCATCGTCCGTGATGCCGACGCCATCG
AGGCCGTCGTCGCCCCCCACGGCCGCGCCCTCATCGACCTCTATTTCGACGTCGTCCATCCGGCCTTTCCGATAG
TCCAGAAGCACGTCTTGTTGCAAAAGTATGACAACTCGCACCGCGACCTGTCGCCTCCGATCCTGGCCGCCGTCT
ATATCCTGGCCATCAACTGGTGGGAGCAGTGCGAGGCCCTGGCAGCTCTGCCCCGACCTGATGTGCGCGAGCTCG
AGCGGCTGGTCCGCAGCACGCTGCAGGACGCCTTGAACCGACCCCGGCTGTCCACCATTCAGGCCGGTCTGTTGC
TGTCGCAGCGGCCCGAGGGCGACCAGTGGGCGCCTACCGCTCAGCTCGTCGCCGTCGGCCAGGAGCTTGGGCTGC
ACCTCGACTGCTCCGGCTGGAAGATTCCCCCCTGGGAAAAGGGTCTGCGGAGACGACTCGCCTGGGCCCTGTATA
TGCAGGACAAATGGGGTGCTCTGGTCCACGGCCGCCCGTCGCACATCTTGGCCGCCAACTGGGCCGTCCGCCCCG
TCTCAGCTCAAGACTTTCCCGACGCCGACTCGGAAGAGGCTGACCCGGACGGCCGCCGCAGAATTGAGAGTGGTC
GCCTGCTCTTCACCCGCGCCATCCAGCTGTCCGAGATCCTGGCCGAGATCCTCGAGACCTTTTACACGCTGCAGT
CGGCTCGTACCATTGCCGATGCCGGCTCGCAGGCCACCCAGCTGGTGCTGTCCATGGCGAAGCCGGTCCAGCTGA
AGCTCAAGGAGTGGTACGCCGGCCTCCCCGCTGCCCTGCGACTCGACGCCTACTCGGCCGGCAGTCCGCCGGTGA
CGCAGACGGGGCGGCGGCTGTCGAGCATCGGCCACCTCCACCTGGCCTACTTCGCTACGGAAATCACACTCCACC
GGCGCATCATCCGGTCGCTGGCGTCCGACCCGGCGTCGGTCGATCCTTACGTCCAGCACATCTGCCGCGGCGCCG
CCAAGGCCCGGCTCATCTCCGCCATGGACTTTGTCAACCGCCTGACGCCTGGCCACCTCCGATCCTTTTGGTACT
TTGCCTCCAAGACCAACTTTGCCTTGATCGGCACCTTTGGCTCCCTGCTGTGGGCCACGTCCCCGGGCCGCGAGG
AGGCCGACTGGTACCGGCGACGGCTGGCCGAGTACCGCTGGACGCTGTCTGTCAGCTCCAAGCCGGGCGAGGGCC
GGGGCCTCACCGAATTCGCCATGTCGATGCTGGACATATCGACTGGCCTCCTGAAGCAGCTTCCGGAGAAACCAT
CGATGAGCCGCAGCACCAGCTTCGTCGATCTGTCGGTCCCTGTTGGTCCCTCGCCCTTCGGCCCCACCCTCTCCG
GCCCCACGCGGCGTGGAGCCGGCGGAGTGGCCTTTCTGCACCGTTTGGCCACTGCGCCCGGTTCCGACGTAAGCG
GTGCGCAGAGCCCTGGTAGCGCAGAATCAACGAGTGACGACGAAATGGACGGCAGCTACACGACACCGGCGTGAA
GAAGCGGTTCGAGGCTTTCCCGGTCAAGGTTAGGATTCCTTTTTGGTGCTCCTATTTAGTTTCTGGCTCTTGGCC
TCTTCTTCACCTTCCTTCTTCCTTTCGCTGTAATGGGTTCTTTTATCCTTATTTTGATGGACTGAGCGAATCGTG
CGAAACAGGAGGCAAGGCGCTTCAGAGAAAGACAGGCGGATGGAAGCAGGCGATCCACAAGACAAGAAATCTCGA
ACACATGGAGGAAGCCGAGGCATCTCGGAATGGACTGTGTGTACGTGAAATGGGTATTCGTTATGACAATGACAC
CAATTCCTCGAAAAGAGCTGCAAAGAGGGCTAATGAGGTCATCATACTGACGTTGTAGATTCCGAGGCGATGACG
GCAGTGTCAAAACGTACAAAGGCTACCCTGGACCCTAGACCCAGCACAGGAGGAGCTCATGTTTGCTGACTAAAG
AAACGTCTCAACCAGGATTTCCTCTTTAGGTGGTGGTCTCGACAGCGATTGGGCGTCTTTGTCCGCCGTGAATGC
CGCTGCGACTGAGGTTCGACGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail