Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3834
Gene name
Locationscaffold_3:111779..113920
Strand-
Gene length (bp)2141
Transcript length (bp)2085
Coding sequence length (bp)2082
Protein length (aa) 694

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08118 MDM31_MDM32 Yeast mitochondrial distribution and morphology (MDM) proteins 1.5E-240 158 689

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38880|MDM31_YEAST Mitochondrial distribution and morphology protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM31 PE=1 SV=1 158 691 2.0E-146
sp|Q10070|MDM31_SCHPO Mitochondrial distribution and morphology protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm31 PE=3 SV=1 171 505 7.0E-91
sp|Q753C5|MDM32_ASHGO Mitochondrial distribution and morphology protein 32 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDM32 PE=3 SV=1 144 543 3.0E-54
sp|A7THL9|MDM32_VANPO Mitochondrial distribution and morphology protein 32 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDM32 PE=3 SV=1 144 503 8.0E-54
sp|Q6CUA4|MDM32_KLULA Mitochondrial distribution and morphology protein 32 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDM32 PE=3 SV=1 144 505 4.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38880|MDM31_YEAST Mitochondrial distribution and morphology protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM31 PE=1 SV=1 158 691 2.0E-146
sp|Q10070|MDM31_SCHPO Mitochondrial distribution and morphology protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm31 PE=3 SV=1 171 505 7.0E-91
sp|Q753C5|MDM32_ASHGO Mitochondrial distribution and morphology protein 32 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDM32 PE=3 SV=1 144 543 3.0E-54
sp|A7THL9|MDM32_VANPO Mitochondrial distribution and morphology protein 32 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDM32 PE=3 SV=1 144 503 8.0E-54
sp|Q6CUA4|MDM32_KLULA Mitochondrial distribution and morphology protein 32 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDM32 PE=3 SV=1 144 505 4.0E-51
sp|Q6FMB2|MDM32_CANGA Mitochondrial distribution and morphology protein 32 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDM32 PE=3 SV=1 141 620 3.0E-47
sp|Q10070|MDM31_SCHPO Mitochondrial distribution and morphology protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm31 PE=3 SV=1 578 689 3.0E-31
sp|Q12171|MDM32_YEAST Mitochondrial distribution and morphology protein 32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM32 PE=1 SV=2 140 502 5.0E-30
sp|A6ZNZ1|MDM32_YEAS7 Mitochondrial distribution and morphology protein 32 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDM32 PE=3 SV=2 140 502 2.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0000001 mitochondrion inheritance Yes
GO:0005743 mitochondrial inner membrane Yes
GO:0007005 mitochondrion organization Yes
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0019866 organelle inner membrane No
GO:0016020 membrane No
GO:0051179 localization No
GO:0051640 organelle localization No
GO:0031966 mitochondrial membrane No
GO:0110165 cellular anatomical entity No
GO:0006996 organelle organization No
GO:0031090 organelle membrane No
GO:0005575 cellular_component No
GO:0016043 cellular component organization No
GO:0051646 mitochondrion localization No
GO:0048311 mitochondrion distribution No
GO:0048308 organelle inheritance No
GO:0071840 cellular component organization or biogenesis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 204 226 22
2 673 690 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3834
MSKALSWLVGIRRSVACQPPRTLDGLQYGTAFLLSRQAPSKIFLILRALSHEGARCRPSNAPERFIHGPPGLPRN
HGGHTDISSSTWNSQYRLYSGELRRPSRKFVSSSDQPRGSSPLRTKLQGDGKPSDSLDGDPGSIASSVSKYLHLS
KIPHRPTKEELLAAANGFWERVRVRFKWMSIRSMRPWNADEWGAFVSWFMLGHLVWILVGTTTFFSIIIFSINTV
FAQETLARWVGDYLTQSAGVTIVFESAIVPKWRNGVIAFRNVYVSRRPGQIESSVSKGSSGAAAVAAAQLAAAPG
AVDDGNYTQFDVTIANVNVTLSFLNWWNGKGLLRDVEVTGVRGVVDRTSVRWPQEQISHLSYRHRHEPGDFEIET
FKLEDLLLTIHHPDGFRPFSVSIYSCELPQLRKQWLFYDFLSASHMSGSFDGSLFTIHPQQVHGIASGHSKRAIA
GTGETNTWKKCSRLRIDGLRIDHLNRGVDGPFGWIYEGNVDIVADVMFPADTDEGIAKVMTDFYDQLEEVVIFNR
AQLLQNSAEARPAALASGLGPKASERTATDWKAEEERSGSGSGNDTGLRFLVMDLRIHLNDVKAAVPLFTRDISY
VNQALVRPIVAYINAKKTYIPITCRIVKQLGDFDGSWTAFDCGLMSDASAETYEAFARDVEDQQSRVRRFKKVGF
WTLSLAVHALFMGMAGNVV
Coding >Ophio5|3834
ATGTCTAAAGCGCTCTCCTGGCTGGTCGGAATTCGCCGCAGCGTGGCATGCCAGCCTCCGAGGACTCTTGATGGC
CTCCAATACGGCACAGCCTTTTTGCTCTCGCGTCAAGCACCGTCGAAGATATTTTTGATACTGCGAGCGTTATCA
CATGAAGGGGCTCGATGTCGGCCGAGCAACGCCCCTGAGCGATTCATACACGGTCCGCCCGGTCTGCCGAGGAAT
CACGGCGGTCATACCGACATCTCTTCGTCAACATGGAACTCGCAGTACCGATTATACAGTGGCGAGCTGCGAAGA
CCGTCTCGAAAGTTTGTGTCGTCCTCTGACCAGCCTCGGGGCTCTTCTCCCCTTCGTACCAAGCTTCAGGGCGAT
GGGAAACCATCGGATAGTCTGGACGGTGATCCCGGATCCATAGCGTCGTCTGTCTCCAAGTATCTCCACCTTTCA
AAGATTCCTCATCGTCCGACCAAGGAGGAGCTGTTGGCAGCTGCCAATGGATTCTGGGAAAGAGTCAGAGTTCGG
TTCAAATGGATGTCCATCAGGAGCATGAGACCATGGAACGCTGACGAATGGGGGGCTTTCGTATCGTGGTTCATG
CTCGGCCATCTCGTTTGGATCCTGGTTGGGACGACTACGTTTTTCTCCATCATCATCTTCTCCATTAACACCGTC
TTCGCTCAGGAGACTCTTGCGAGGTGGGTGGGCGACTATCTGACACAATCTGCCGGCGTCACCATCGTTTTCGAA
TCGGCTATTGTGCCCAAATGGCGTAATGGCGTCATCGCCTTCCGCAACGTGTATGTCTCTCGACGGCCCGGCCAA
ATCGAATCGTCCGTCAGCAAGGGTTCATCCGGTGCGGCCGCCGTCGCCGCCGCACAGTTAGCCGCCGCTCCCGGT
GCGGTGGATGATGGCAACTATACACAGTTTGACGTTACTATTGCAAACGTCAACGTCACGCTGTCTTTTCTCAAC
TGGTGGAATGGCAAGGGACTGCTCAGAGATGTCGAGGTGACTGGCGTTCGAGGGGTAGTAGACCGGACGTCGGTG
CGCTGGCCACAGGAGCAAATCAGTCACCTTTCGTACCGCCACCGTCATGAACCTGGAGACTTCGAAATCGAGACG
TTTAAGCTGGAGGATCTCCTGCTGACCATACATCATCCTGACGGTTTCCGGCCTTTTTCAGTCAGTATCTACTCA
TGCGAACTGCCCCAATTGCGGAAACAGTGGCTGTTCTACGACTTCTTGTCGGCTAGCCACATGTCGGGCTCCTTC
GACGGCTCCCTATTCACAATACACCCTCAACAAGTACACGGCATAGCCTCTGGCCACAGCAAGCGCGCCATAGCA
GGCACGGGTGAGACGAATACTTGGAAAAAATGTAGCAGGCTCAGGATAGACGGGCTGAGGATCGACCACCTGAAT
CGTGGCGTCGATGGGCCCTTTGGGTGGATATATGAGGGCAACGTGGACATAGTGGCAGACGTCATGTTCCCTGCC
GACACTGATGAGGGCATTGCCAAAGTCATGACGGACTTTTACGATCAGCTCGAGGAGGTGGTGATCTTTAACCGA
GCTCAGCTGCTTCAGAACTCTGCCGAAGCAAGACCCGCCGCACTCGCATCGGGACTTGGCCCAAAAGCATCCGAG
CGCACGGCGACAGACTGGAAGGCAGAAGAAGAGAGGAGCGGGAGCGGAAGCGGGAATGACACTGGTCTGCGATTC
CTCGTCATGGACCTGCGTATTCATCTCAACGACGTCAAGGCCGCCGTACCCCTTTTCACGCGAGACATATCGTAC
GTCAACCAGGCCCTCGTGCGTCCCATTGTCGCCTACATCAACGCGAAGAAGACGTACATTCCCATCACTTGCCGC
ATCGTCAAGCAGCTCGGCGACTTTGATGGCAGCTGGACCGCCTTCGACTGTGGACTCATGAGCGACGCGTCGGCC
GAGACGTACGAGGCTTTTGCAAGGGATGTCGAGGACCAGCAGAGTCGCGTGCGGCGCTTCAAAAAGGTTGGTTTC
TGGACCTTGTCACTGGCTGTGCACGCGCTCTTCATGGGGATGGCTGGCAACGTCGTG
Transcript >Ophio5|3834
ATGTCTAAAGCGCTCTCCTGGCTGGTCGGAATTCGCCGCAGCGTGGCATGCCAGCCTCCGAGGACTCTTGATGGC
CTCCAATACGGCACAGCCTTTTTGCTCTCGCGTCAAGCACCGTCGAAGATATTTTTGATACTGCGAGCGTTATCA
CATGAAGGGGCTCGATGTCGGCCGAGCAACGCCCCTGAGCGATTCATACACGGTCCGCCCGGTCTGCCGAGGAAT
CACGGCGGTCATACCGACATCTCTTCGTCAACATGGAACTCGCAGTACCGATTATACAGTGGCGAGCTGCGAAGA
CCGTCTCGAAAGTTTGTGTCGTCCTCTGACCAGCCTCGGGGCTCTTCTCCCCTTCGTACCAAGCTTCAGGGCGAT
GGGAAACCATCGGATAGTCTGGACGGTGATCCCGGATCCATAGCGTCGTCTGTCTCCAAGTATCTCCACCTTTCA
AAGATTCCTCATCGTCCGACCAAGGAGGAGCTGTTGGCAGCTGCCAATGGATTCTGGGAAAGAGTCAGAGTTCGG
TTCAAATGGATGTCCATCAGGAGCATGAGACCATGGAACGCTGACGAATGGGGGGCTTTCGTATCGTGGTTCATG
CTCGGCCATCTCGTTTGGATCCTGGTTGGGACGACTACGTTTTTCTCCATCATCATCTTCTCCATTAACACCGTC
TTCGCTCAGGAGACTCTTGCGAGGTGGGTGGGCGACTATCTGACACAATCTGCCGGCGTCACCATCGTTTTCGAA
TCGGCTATTGTGCCCAAATGGCGTAATGGCGTCATCGCCTTCCGCAACGTGTATGTCTCTCGACGGCCCGGCCAA
ATCGAATCGTCCGTCAGCAAGGGTTCATCCGGTGCGGCCGCCGTCGCCGCCGCACAGTTAGCCGCCGCTCCCGGT
GCGGTGGATGATGGCAACTATACACAGTTTGACGTTACTATTGCAAACGTCAACGTCACGCTGTCTTTTCTCAAC
TGGTGGAATGGCAAGGGACTGCTCAGAGATGTCGAGGTGACTGGCGTTCGAGGGGTAGTAGACCGGACGTCGGTG
CGCTGGCCACAGGAGCAAATCAGTCACCTTTCGTACCGCCACCGTCATGAACCTGGAGACTTCGAAATCGAGACG
TTTAAGCTGGAGGATCTCCTGCTGACCATACATCATCCTGACGGTTTCCGGCCTTTTTCAGTCAGTATCTACTCA
TGCGAACTGCCCCAATTGCGGAAACAGTGGCTGTTCTACGACTTCTTGTCGGCTAGCCACATGTCGGGCTCCTTC
GACGGCTCCCTATTCACAATACACCCTCAACAAGTACACGGCATAGCCTCTGGCCACAGCAAGCGCGCCATAGCA
GGCACGGGTGAGACGAATACTTGGAAAAAATGTAGCAGGCTCAGGATAGACGGGCTGAGGATCGACCACCTGAAT
CGTGGCGTCGATGGGCCCTTTGGGTGGATATATGAGGGCAACGTGGACATAGTGGCAGACGTCATGTTCCCTGCC
GACACTGATGAGGGCATTGCCAAAGTCATGACGGACTTTTACGATCAGCTCGAGGAGGTGGTGATCTTTAACCGA
GCTCAGCTGCTTCAGAACTCTGCCGAAGCAAGACCCGCCGCACTCGCATCGGGACTTGGCCCAAAAGCATCCGAG
CGCACGGCGACAGACTGGAAGGCAGAAGAAGAGAGGAGCGGGAGCGGAAGCGGGAATGACACTGGTCTGCGATTC
CTCGTCATGGACCTGCGTATTCATCTCAACGACGTCAAGGCCGCCGTACCCCTTTTCACGCGAGACATATCGTAC
GTCAACCAGGCCCTCGTGCGTCCCATTGTCGCCTACATCAACGCGAAGAAGACGTACATTCCCATCACTTGCCGC
ATCGTCAAGCAGCTCGGCGACTTTGATGGCAGCTGGACCGCCTTCGACTGTGGACTCATGAGCGACGCGTCGGCC
GAGACGTACGAGGCTTTTGCAAGGGATGTCGAGGACCAGCAGAGTCGCGTGCGGCGCTTCAAAAAGGTTGGTTTC
TGGACCTTGTCACTGGCTGTGCACGCGCTCTTCATGGGGATGGCTGGCAACGTCGTGTAG
Gene >Ophio5|3834
ATGTCTAAAGCGCTCTCCTGGCTGGTCGGAATTCGCCGCAGCGTGGCATGCCAGCCTCCGAGGACTCTTGATGGC
CTCCAATACGGCACAGCCTTTTTGCTCTCGCGTCAAGCACCGTCGAAGATATTTTTGATACTGCGAGCGTTATCA
CATGAAGGGGCTCGATGTCGGCCGAGCAACGCCCCTGAGCGATTCATACACGGTCCGCCCGGTCTGCCGAGGAAT
CACGGCGGTCATACCGACATCTCTTCGTCAACATGGAACTCGCAGTACCGATTATACAGTGGCGAGCTGCGAAGA
CCGTCTCGAAAGTTTGTGTCGTCCTCTGACCAGCCTCGGGGCTCTTCTCCCCTTCGTACCAAGCTTCAGGGCGAT
GGGAAACCATCGGATAGTCTGGACGGTGATCCCGGATCCATAGCGTCGTCTGTCTCCAAGTATCTCCACCTTTCA
AAGATTCCTCATCGTCCGACCAAGGAGGAGCTGTTGGCAGCTGCCAATGGATTCTGGGAAAGAGTCAGAGTTCGG
TTCAAATGGATGTCCATCAGGAGCATGAGACCATGGAACGCTGACGAATGGGGGGCTTTCGTATCGTGGTTCATG
CTCGGCCATCTCGTTTGGATCCTGGTTGGGACGACTACGTTTTTCTCCATCATCATCTTCTCCATTAACACCGTC
TTCGCTCAGGGTAAAAGCCGGCGTGACCACGCTCAGGCACGATGACTATTGCTAATACGTCGCCAGAGACTCTTG
CGAGGTGGGTGGGCGACTATCTGACACAATCTGCCGGCGTCACCATCGTTTTCGAATCGGCTATTGTGCCCAAAT
GGCGTAATGGCGTCATCGCCTTCCGCAACGTGTATGTCTCTCGACGGCCCGGCCAAATCGAATCGTCCGTCAGCA
AGGGTTCATCCGGTGCGGCCGCCGTCGCCGCCGCACAGTTAGCCGCCGCTCCCGGTGCGGTGGATGATGGCAACT
ATACACAGTTTGACGTTACTATTGCAAACGTCAACGTCACGCTGTCTTTTCTCAACTGGTGGAATGGCAAGGGAC
TGCTCAGAGATGTCGAGGTGACTGGCGTTCGAGGGGTAGTAGACCGGACGTCGGTGCGCTGGCCACAGGAGCAAA
TCAGTCACCTTTCGTACCGCCACCGTCATGAACCTGGAGACTTCGAAATCGAGACGTTTAAGCTGGAGGATCTCC
TGCTGACCATACATCATCCTGACGGTTTCCGGCCTTTTTCAGTCAGTATCTACTCATGCGAACTGCCCCAATTGC
GGAAACAGTGGCTGTTCTACGACTTCTTGTCGGCTAGCCACATGTCGGGCTCCTTCGACGGCTCCCTATTCACAA
TACACCCTCAACAAGTACACGGCATAGCCTCTGGCCACAGCAAGCGCGCCATAGCAGGCACGGGTGAGACGAATA
CTTGGAAAAAATGTAGCAGGCTCAGGATAGACGGGCTGAGGATCGACCACCTGAATCGTGGCGTCGATGGGCCCT
TTGGGTGGATATATGAGGGCAACGTGGACATAGTGGCAGACGTCATGTTCCCTGCCGACACTGATGAGGGCATTG
CCAAAGTCATGACGGACTTTTACGATCAGCTCGAGGAGGTGGTGATCTTTAACCGAGCTCAGCTGCTTCAGAACT
CTGCCGAAGCAAGACCCGCCGCACTCGCATCGGGACTTGGCCCAAAAGCATCCGAGCGCACGGCGACAGACTGGA
AGGCAGAAGAAGAGAGGAGCGGGAGCGGAAGCGGGAATGACACTGGTCTGCGATTCCTCGTCATGGACCTGCGTA
TTCATCTCAACGACGTCAAGGCCGCCGTACCCCTTTTCACGCGAGACATATCGTACGTCAACCAGGCCCTCGTGC
GTCCCATTGTCGCCTACATCAACGCGAAGAAGACGTACATTCCCATCACTTGCCGCATCGTCAAGCAGCTCGGCG
ACTTTGATGGCAGCTGGACCGCCTTCGACTGTGGACTCATGAGCGACGCGTCGGCCGAGACGTACGAGGCTTTTG
CAAGGGATGTCGAGGACCAGCAGAGTCGCGTGCGGCGCTTCAAAAAGGTTGGTTTCTGGACCTTGTCACTGGCTG
TGCACGCGCTCTTCATGGGGATGGCTGGCAACGTCGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail