Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3811
Gene name
Locationscaffold_3:53715..56783
Strand+
Gene length (bp)3068
Transcript length (bp)2763
Coding sequence length (bp)2760
Protein length (aa) 920

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04121 Nup84_Nup100 Nuclear pore protein 84 / 107 1.6E-177 103 887

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0SER9|NUP84_CHATD Nucleoporin NUP84 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP84 PE=3 SV=1 7 920 0.0E+00
sp|Q10331|NU107_SCHPO Nucleoporin nup107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup107 PE=1 SV=4 38 895 6.0E-38
sp|P57740|NU107_HUMAN Nuclear pore complex protein Nup107 OS=Homo sapiens GN=NUP107 PE=1 SV=1 96 559 3.0E-16
sp|P52590|NU107_RAT Nuclear pore complex protein Nup107 OS=Rattus norvegicus GN=Nup107 PE=1 SV=1 96 455 9.0E-15
sp|Q8BH74|NU107_MOUSE Nuclear pore complex protein Nup107 OS=Mus musculus GN=Nup107 PE=1 SV=1 96 458 6.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0SER9|NUP84_CHATD Nucleoporin NUP84 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP84 PE=3 SV=1 7 920 0.0E+00
sp|Q10331|NU107_SCHPO Nucleoporin nup107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup107 PE=1 SV=4 38 895 6.0E-38
sp|P57740|NU107_HUMAN Nuclear pore complex protein Nup107 OS=Homo sapiens GN=NUP107 PE=1 SV=1 96 559 3.0E-16
sp|P52590|NU107_RAT Nuclear pore complex protein Nup107 OS=Rattus norvegicus GN=Nup107 PE=1 SV=1 96 455 9.0E-15
sp|Q8BH74|NU107_MOUSE Nuclear pore complex protein Nup107 OS=Mus musculus GN=Nup107 PE=1 SV=1 96 458 6.0E-14
sp|P52891|NUP84_YEAST Nucleoporin NUP84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP84 PE=1 SV=1 318 701 4.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005643 nuclear pore Yes
GO:0017056 structural constituent of nuclear pore Yes
GO:0140513 nuclear protein-containing complex No
GO:0005198 structural molecule activity No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3594 0.8844 0.1707 0.0222 0.0187 0.0011 0.0579 0.0309 0.1311 0.0054

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1555
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4039
Ophiocordyceps australis map64 (Brazil) OphauB2|528
Ophiocordyceps camponoti-floridani Ophcf2|00129
Ophiocordyceps camponoti-rufipedis Ophun1|2961
Ophiocordyceps kimflemingae Ophio5|3811 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1130

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3811
MESDKEPKEANGNKENSNKTRMTPGPLVEAFATALDGCLVPNLSALEKRARILDLPRKFHESAIRQLMQKRPKRS
RDGISDVDMDVDDKDNTKADSKEQEKIKLLEKEVQTWDLVRRLLPLRHSVAQTTASLFEAAAKPSQATSLDVFVD
ADPVVKERRAVLQWLQTTAASGPDIDELARDLQQNADRGDIIAHGWLHTRSRIKLRKSVTAWPHLLDKQSSTVAA
SHTSSDGSPLVTHLDPDAATRQGCKLEPQDEYFERAIWLGCFEHLRRGSSLQTIREWCHERTEMWRAISMSGLLL
PADGKERLTETPPTSLVMWRRMCLSLARNGGTDDYERAVYGLLSGDISSVEQVAKSWDDHLFAHFNALVRTQIDT
FLLGLCPPELNSKMARDFPSTDAVQFHVGLDSVEKRLIGTLESQKDTREEALEPHKSLQASLIANDLDSHLYEQA
RVLTEEANRDEQSRLLPRNILWQPLLRGGDGVVEDKFFHLEQHEGLRIVSHICVLMALLRQLDEKESGSRFQLGL
SRADDASESIIAAYTDLLERANLKELIPLYCSVLHRRRYEVLGWNMIKEEDAVRRMSQLKIMSKIGINVLEFVET
LAKLVFGQIENDDGDTAVEKKAFKIVVPGPPTGRIKRVISANFIAEPLTEISTTDEQIIRSLEWLLLVEAAWPEV
LRIGVQAYKLFYRNQRLLAARRLMERVQFDAILLVLNDEDIDAALLDDVDFWARQLEQSGVTNAKPEQVMTNARD
YRDLENLAKALDSLEDVASRMKDMQKVPSADSNAWRELGNSTKAMRERMHPLLKEWLLTSIEAGDSELHELRQRF
LPEATLAMVNGLHLAGTGLSRDNLLDSMDLATSIAEPDSDLAKSFIEAGRMRELVEAFAACSRALATVKGEKRAA
GTSKKMREMGWARDLWSVGS
Coding >Ophio5|3811
ATGGAGTCGGACAAGGAGCCCAAGGAGGCAAATGGCAACAAGGAAAATTCAAACAAGACAAGGATGACGCCAGGC
CCGCTCGTCGAGGCCTTCGCCACCGCTCTTGATGGCTGTCTTGTACCGAACCTAAGCGCGCTCGAAAAGCGAGCC
CGGATTTTGGATCTTCCTCGGAAATTCCACGAGAGCGCGATCCGACAGCTGATGCAGAAACGGCCGAAACGCTCT
CGCGATGGGATTAGTGACGTCGACATGGATGTTGACGACAAGGACAACACCAAGGCAGACTCCAAGGAACAGGAA
AAGATCAAGCTACTGGAGAAAGAGGTACAAACATGGGATCTCGTCCGCCGCCTCCTCCCCCTGCGACATTCGGTG
GCGCAGACGACCGCCTCGCTCTTCGAAGCGGCAGCAAAGCCCTCGCAGGCCACTTCGCTTGACGTCTTCGTCGAT
GCCGACCCCGTCGTCAAAGAGCGACGAGCCGTGCTCCAGTGGTTGCAGACGACGGCAGCGTCTGGCCCCGACATC
GACGAGTTGGCGCGCGACCTGCAGCAGAATGCCGACAGGGGAGATATCATCGCCCACGGTTGGCTTCATACCCGC
TCCCGGATAAAGCTGAGAAAAAGTGTGACCGCATGGCCACACCTGCTGGACAAGCAGTCTTCCACCGTCGCGGCG
TCCCACACCAGCTCGGACGGCTCGCCGCTCGTCACCCACCTGGACCCGGACGCGGCGACGCGGCAAGGCTGCAAG
CTTGAGCCCCAGGACGAGTATTTTGAGCGTGCGATCTGGTTGGGCTGTTTTGAGCACCTACGCCGCGGCAGCAGT
CTGCAAACCATTCGCGAATGGTGCCACGAGCGTACCGAGATGTGGAGGGCCATATCCATGTCGGGGTTACTGCTT
CCTGCTGACGGCAAGGAGCGCCTGACGGAGACGCCCCCGACTTCCCTGGTGATGTGGCGGCGCATGTGCCTGAGT
CTAGCTCGGAACGGCGGCACAGACGATTACGAACGCGCCGTATACGGCCTGTTGTCAGGAGACATCTCCAGCGTG
GAGCAGGTGGCTAAAAGCTGGGATGACCATCTCTTCGCCCACTTCAACGCTCTCGTTCGAACTCAGATCGACACC
TTTCTCCTGGGCCTATGCCCGCCCGAGCTGAACTCGAAGATGGCACGGGACTTCCCATCAACGGATGCCGTGCAA
TTCCACGTCGGATTGGACAGTGTCGAGAAGCGGCTCATAGGGACGCTTGAGTCTCAAAAGGACACCCGGGAGGAG
GCCTTGGAGCCACACAAGTCTCTACAGGCCTCGCTGATAGCCAACGACCTGGATAGCCACCTGTACGAGCAGGCG
CGAGTTCTGACCGAAGAAGCAAACAGAGACGAGCAGTCACGGCTACTGCCGCGGAACATTCTATGGCAGCCTCTT
TTACGCGGCGGAGATGGTGTCGTTGAAGACAAATTTTTCCACCTGGAACAGCATGAGGGCCTCCGCATCGTGAGC
CACATATGCGTGCTCATGGCCCTTCTGCGCCAGTTGGACGAGAAGGAAAGCGGGTCACGTTTCCAACTTGGATTG
TCGCGCGCTGACGACGCTTCGGAGAGCATCATCGCCGCCTACACGGACCTTTTGGAGCGGGCCAACCTCAAAGAG
CTCATACCTCTTTACTGCTCCGTCCTGCATCGTCGACGCTACGAGGTGCTTGGCTGGAACATGATCAAGGAGGAG
GATGCCGTGCGGCGCATGTCGCAGCTGAAGATCATGAGCAAGATCGGCATCAACGTGCTAGAGTTTGTCGAGACG
CTGGCAAAGCTAGTGTTTGGGCAGATTGAGAACGACGACGGCGACACAGCCGTTGAGAAGAAGGCTTTCAAGATA
GTTGTTCCAGGTCCGCCAACGGGGAGGATTAAGCGAGTCATCAGCGCCAATTTCATCGCCGAACCCCTTACAGAG
ATATCGACGACGGATGAGCAAATCATTCGGTCGCTGGAGTGGCTTCTACTGGTGGAAGCGGCATGGCCCGAGGTG
TTGCGCATCGGAGTGCAGGCGTACAAGCTCTTCTACAGGAACCAGCGCTTGCTGGCGGCGCGGAGGCTCATGGAG
CGGGTGCAATTCGATGCCATCTTACTGGTGCTCAACGACGAGGACATCGATGCCGCACTCCTGGACGATGTCGAC
TTTTGGGCGCGGCAACTCGAACAAAGCGGAGTCACCAACGCAAAGCCGGAGCAGGTGATGACGAATGCGCGAGAC
TATCGTGATCTGGAGAATCTCGCCAAGGCGCTTGACAGCCTGGAGGACGTGGCATCTCGGATGAAAGACATGCAA
AAGGTGCCATCGGCCGACTCCAATGCGTGGAGAGAGCTGGGAAACAGTACCAAGGCCATGAGGGAGAGAATGCAC
CCACTCCTGAAAGAGTGGCTGTTGACGAGCATCGAAGCGGGCGACTCGGAGCTTCACGAACTGCGACAGAGGTTT
TTGCCCGAGGCGACACTGGCCATGGTGAACGGCCTGCACCTAGCGGGCACCGGCCTCAGCCGCGATAACCTGCTC
GACAGCATGGACCTCGCCACATCCATCGCCGAGCCGGATTCGGACCTGGCCAAGTCGTTCATCGAGGCAGGGCGG
ATGAGAGAGCTGGTGGAAGCATTTGCCGCGTGCAGCAGAGCGCTCGCCACGGTCAAGGGCGAGAAGAGGGCGGCC
GGTACGAGCAAGAAGATGCGAGAAATGGGATGGGCGCGCGATCTTTGGTCGGTAGGTAGT
Transcript >Ophio5|3811
ATGGAGTCGGACAAGGAGCCCAAGGAGGCAAATGGCAACAAGGAAAATTCAAACAAGACAAGGATGACGCCAGGC
CCGCTCGTCGAGGCCTTCGCCACCGCTCTTGATGGCTGTCTTGTACCGAACCTAAGCGCGCTCGAAAAGCGAGCC
CGGATTTTGGATCTTCCTCGGAAATTCCACGAGAGCGCGATCCGACAGCTGATGCAGAAACGGCCGAAACGCTCT
CGCGATGGGATTAGTGACGTCGACATGGATGTTGACGACAAGGACAACACCAAGGCAGACTCCAAGGAACAGGAA
AAGATCAAGCTACTGGAGAAAGAGGTACAAACATGGGATCTCGTCCGCCGCCTCCTCCCCCTGCGACATTCGGTG
GCGCAGACGACCGCCTCGCTCTTCGAAGCGGCAGCAAAGCCCTCGCAGGCCACTTCGCTTGACGTCTTCGTCGAT
GCCGACCCCGTCGTCAAAGAGCGACGAGCCGTGCTCCAGTGGTTGCAGACGACGGCAGCGTCTGGCCCCGACATC
GACGAGTTGGCGCGCGACCTGCAGCAGAATGCCGACAGGGGAGATATCATCGCCCACGGTTGGCTTCATACCCGC
TCCCGGATAAAGCTGAGAAAAAGTGTGACCGCATGGCCACACCTGCTGGACAAGCAGTCTTCCACCGTCGCGGCG
TCCCACACCAGCTCGGACGGCTCGCCGCTCGTCACCCACCTGGACCCGGACGCGGCGACGCGGCAAGGCTGCAAG
CTTGAGCCCCAGGACGAGTATTTTGAGCGTGCGATCTGGTTGGGCTGTTTTGAGCACCTACGCCGCGGCAGCAGT
CTGCAAACCATTCGCGAATGGTGCCACGAGCGTACCGAGATGTGGAGGGCCATATCCATGTCGGGGTTACTGCTT
CCTGCTGACGGCAAGGAGCGCCTGACGGAGACGCCCCCGACTTCCCTGGTGATGTGGCGGCGCATGTGCCTGAGT
CTAGCTCGGAACGGCGGCACAGACGATTACGAACGCGCCGTATACGGCCTGTTGTCAGGAGACATCTCCAGCGTG
GAGCAGGTGGCTAAAAGCTGGGATGACCATCTCTTCGCCCACTTCAACGCTCTCGTTCGAACTCAGATCGACACC
TTTCTCCTGGGCCTATGCCCGCCCGAGCTGAACTCGAAGATGGCACGGGACTTCCCATCAACGGATGCCGTGCAA
TTCCACGTCGGATTGGACAGTGTCGAGAAGCGGCTCATAGGGACGCTTGAGTCTCAAAAGGACACCCGGGAGGAG
GCCTTGGAGCCACACAAGTCTCTACAGGCCTCGCTGATAGCCAACGACCTGGATAGCCACCTGTACGAGCAGGCG
CGAGTTCTGACCGAAGAAGCAAACAGAGACGAGCAGTCACGGCTACTGCCGCGGAACATTCTATGGCAGCCTCTT
TTACGCGGCGGAGATGGTGTCGTTGAAGACAAATTTTTCCACCTGGAACAGCATGAGGGCCTCCGCATCGTGAGC
CACATATGCGTGCTCATGGCCCTTCTGCGCCAGTTGGACGAGAAGGAAAGCGGGTCACGTTTCCAACTTGGATTG
TCGCGCGCTGACGACGCTTCGGAGAGCATCATCGCCGCCTACACGGACCTTTTGGAGCGGGCCAACCTCAAAGAG
CTCATACCTCTTTACTGCTCCGTCCTGCATCGTCGACGCTACGAGGTGCTTGGCTGGAACATGATCAAGGAGGAG
GATGCCGTGCGGCGCATGTCGCAGCTGAAGATCATGAGCAAGATCGGCATCAACGTGCTAGAGTTTGTCGAGACG
CTGGCAAAGCTAGTGTTTGGGCAGATTGAGAACGACGACGGCGACACAGCCGTTGAGAAGAAGGCTTTCAAGATA
GTTGTTCCAGGTCCGCCAACGGGGAGGATTAAGCGAGTCATCAGCGCCAATTTCATCGCCGAACCCCTTACAGAG
ATATCGACGACGGATGAGCAAATCATTCGGTCGCTGGAGTGGCTTCTACTGGTGGAAGCGGCATGGCCCGAGGTG
TTGCGCATCGGAGTGCAGGCGTACAAGCTCTTCTACAGGAACCAGCGCTTGCTGGCGGCGCGGAGGCTCATGGAG
CGGGTGCAATTCGATGCCATCTTACTGGTGCTCAACGACGAGGACATCGATGCCGCACTCCTGGACGATGTCGAC
TTTTGGGCGCGGCAACTCGAACAAAGCGGAGTCACCAACGCAAAGCCGGAGCAGGTGATGACGAATGCGCGAGAC
TATCGTGATCTGGAGAATCTCGCCAAGGCGCTTGACAGCCTGGAGGACGTGGCATCTCGGATGAAAGACATGCAA
AAGGTGCCATCGGCCGACTCCAATGCGTGGAGAGAGCTGGGAAACAGTACCAAGGCCATGAGGGAGAGAATGCAC
CCACTCCTGAAAGAGTGGCTGTTGACGAGCATCGAAGCGGGCGACTCGGAGCTTCACGAACTGCGACAGAGGTTT
TTGCCCGAGGCGACACTGGCCATGGTGAACGGCCTGCACCTAGCGGGCACCGGCCTCAGCCGCGATAACCTGCTC
GACAGCATGGACCTCGCCACATCCATCGCCGAGCCGGATTCGGACCTGGCCAAGTCGTTCATCGAGGCAGGGCGG
ATGAGAGAGCTGGTGGAAGCATTTGCCGCGTGCAGCAGAGCGCTCGCCACGGTCAAGGGCGAGAAGAGGGCGGCC
GGTACGAGCAAGAAGATGCGAGAAATGGGATGGGCGCGCGATCTTTGGTCGGTAGGTAGTTGA
Gene >Ophio5|3811
ATGGAGTCGGACAAGGAGCCCAAGGAGGCAAATGGCAACAAGGAAAATTCAAACAAGACAAGGATGACGCCAGGC
CCGCTCGTCGAGGCCTTCGCCACCGCTCTTGATGGCTGTCTTGTACCGAACCTAAGCGCGCTCGAAAAGCGAGCC
CGGATTTTGGATCTTCCTCGGAAATTCCACGAGAGCGCGATCCGACAGCTGATGCAGAAACGGCCGAAACGCTCT
CGCGATGGGATTAGTGACGTCGACATGGATGTTGACGACAAGGACAACACCAAGGCAGACTCCAAGGAACAGGAA
AAGATCAAGCTACTGGAGAAAGAGGTACAAACATGGGATCTCGTCCGCCGCCTCCTCCCCCTGCGACATTCGGTG
GCGCAGACGACCGCCTCGCTCTTCGAAGCGGCAGCAAAGCCCTCGCAGGCCACTTCGCTTGACGTCTTCGTCGAT
GCCGACCCCGTCGTCAAAGAGCGACGAGCCGTGCTCCAGTGGTTGCAGACGACGGCAGCGTCTGGCCCCGACATC
GACGAGTTGGCGCGCGACCTGCAGCAGAATGCCGACAGGGGAGATATCATCGCCCACGGTTGGCTTCATACCCGC
TCCCGGATAAAGCTGAGAAAAAGTGTGACCGCATGGCCACACCTGCTGGACAAGCAGTCTTCCACCGTCGCGGCG
TCCCACACCAGCTCGGACGGCTCGCCGCTCGTCACCCACCTGGACCCGGACGCGGCGACGCGGCAAGGCTGCAAG
CTTGAGCCCCAGGACGAGTATTTTGAGCGTGCGATCTGGTTGGGCTGTTTTGAGCACCTACGCCGCGGCAGCAGT
CTGCAAACCATTCGCGAATGGTGCCACGAGCGTACCGAGATGTGGAGGGCCATATCCATGTCGGGGTTACTGCTT
CCTGCTGACGGCAAGGAGCGCCTGACGGAGACGCCCCCGACTTCCCTGGTGATGTGGCGGCGCATGTGCCTGAGT
CTAGCTCGGAACGGCGGCACAGACGATTACGAACGCGCCGTATACGGCCTGTTGTCAGGAGACATCTCCAGCGTG
GAGCAGGTGGCTAAAAGCTGGGATGACCATCTCTTCGCCCACTTCAACGCTCTCGTTCGAACTCAGATCGACACC
TTTCTCCTGGGCCTATGCCCGCCCGAGCTGAACTCGAAGATGGCACGGGACTTCCCATCAACGGATGCCGTGCAA
TTCCACGTCGGATTGGACAGTGTCGAGAAGCGGCTCATAGGGACGCTTGAGTCTCAAAAGGACACCCGGGAGGAG
GCCTTGGAGCCACACAAGTCTCTACAGGCCTCGCTGATAGCCAACGACCTGGATAGCCACCTGTACGAGCAGGCG
CGAGTTCTGACCGAAGAAGCAAACAGAGACGAGCAGTCACGGCTACTGCCGCGGAACATTCTATGGCAGCCTCTT
TTACGCGGCGGAGATGGTGTCGTTGAAGACAAATTTTTCCACCTGGAACAGCATGAGGGCCTCCGCATCGTGAGC
CACATATGCGTGCTCATGGCCCTTCTGCGCCAGTTGGACGAGAAGGAAAGCGGGTCACGTTTCCAACTTGGATTG
TCGCGCGCTGACGACGCTTCGGAGAGCATCATCGCCGCCTACACGGACCTTTTGGAGCGGGCCAACCTCAAAGAG
CTCATACCTCTTTACTGCTCCGTCCTGCATCGTCGACGCTACGAGGTGCTTGGCTGGAACATGATCAAGGAGGAG
GATGCCGTGCGGCGCATGTCGCAGCTGAAGATCATGAGCAAGATCGGCATCAACGTGCTAGAGTTTGTCGAGACG
CTGGCAAAGCTAGTGTTTGGGCAGATTGAGAACGACGACGGCGACACAGCCGTTGAGAAGAAGGCTTTCAAGATA
GTTGTTCCAGGTCCGCCAACGGGGAGGATTAAGCGAGTCATCAGCGCCAATTTCATCGCCGAACCCCTTACAGAG
ATATCGACGACGGATGAGCAAATCATTCGGTCGCTGGAGTGGCTTCTACTGGTGGAAGCGGCATGGCCCGAGGTG
TTGCGCATCGGAGTGCAGGCGTACAAGCTCTTCTACAGTGAGTCCCAACATGGTACGCGGGTGGCCTGGACTGAC
ACCAGGACAGGGAACCAGCGCTTGCTGGCGGCGCGGAGGCTCATGGAGCGGGTGCAATTCGATGCCATCTTACTG
GTGCTCAACGACGAGGACATCGATGCCGCACTCCTGGACGATGTCGACTTTTGGGCGCGGCAACTCGAACAAAGC
GGAGTCACCAACGCAAAGCCGGAGCAGGTGATGACGAATGCGCGAGACTATCGTGATCTGGAGAATCTCGCCAAG
GCGCTTGACAGCCTGGAGGACGTGGCATCTCGGATGAAAGACATGCAAAAGTAGGTAAACGGCCTCGCGGAAAGG
CAGACTTTGAACTGACGACATCAGGGTGCCATCGGCCGACTCCAATGCGTGGAGAGAGCTGGGAAACAGTACCAA
GGCCATGAGGGAGAGAATGCACCCACTCCTGAAAGAGTGGCTGTTGACGAGCATCGAAGGTAATACAGGGGCCGC
CGCACCTGACGGAAAAGAAAAGATACTGATACGGCGACAGCGGGCGACTCGGAGCTTCACGAACTGCGACAGAGG
TTTTTGCCCGAGGCGACACTGGCCATGGTGAACGGCCTGCACCTAGCGGGCACCGGCCTCAGCCGCGATAACCTG
CTCGACAGCATGGACCTCGCCACATCCATCGCCGAGCCGGATTCGGACCTGGCCAAGTCGTTCATCGAGGCAGGG
CGGATGAGAGAGCTGGTGGAAGCATTTGCCGCGTGCAGCAGAGCGCTCGCCACGGTCAAGGGCGAGAAGAGGGCG
GCCGGTACGAGCAAGAAGATGCGAGAAATGGGATGGGCGCGCGATCTTTGGTCGGTCAAGAATTGACGAGACGAC
GGATGAGCTGTAACGCGAGTCGGCATTCGTACTGGGGAGAACGAGGCCAATGCCCTAGCTAGGTAGGTAGGTAGG
TACAGTGACTTGACACGCGAAACGAGCACGCAGATGTATTTTCGCTTACAATTTATACTGACAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail