Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3798
Gene name
Locationscaffold_3:27347..28979
Strand+
Gene length (bp)1632
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12734 CYSTM Cysteine-rich TM module stress tolerance 1.9E-05 235 277

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5733 0.4517 0.2869 0.207 0.2259 0.3339 0.3175 0.2885 0.2653 0.0219

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1560
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5671
Ophiocordyceps australis map64 (Brazil) OphauB2|2406
Ophiocordyceps camponoti-floridani Ophcf2|00139
Ophiocordyceps camponoti-rufipedis Ophun1|3541
Ophiocordyceps kimflemingae Ophio5|3798 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1140

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3798
MEYKGVARPAIGALDTAPIKRPAQPRRQPTSRPCFFTLSLPLSLSGVFFFGGSVIKDLQPGNSASPGASHSPKGR
FSPSPPYLARFFRRNARHILGQVNLVAAGTRVSIHGPHFAPYRYLTFCPFFGLHPAAEAGGRKPSPPRACFRAFP
SLSNLRRFLLRPTPSLPPSKCDAAPIAALPPSPSYRRRRRRFPAMSNQEYYGGGGYPQHPQPSYGPPQGNYGPPQ
GYNGGYQQGQPPMQYQQAPPPNESRGRRGGSNNCLMACLAALCCCCVAEEGCECCLECCECLC*
Coding >Ophio5|3798
ATGGAATATAAAGGCGTTGCACGGCCAGCCATCGGAGCGTTGGATACCGCCCCAATAAAACGACCTGCCCAACCG
CGAAGGCAACCTACATCTCGGCCTTGTTTCTTCACTCTCTCTCTCCCCCTCTCTCTCTCAGGGGTTTTTTTTTTT
GGCGGTTCCGTGATCAAAGACTTGCAGCCCGGCAACTCGGCATCTCCAGGCGCCAGCCATTCTCCGAAGGGTCGG
TTTTCCCCCTCCCCTCCCTACCTAGCCCGCTTCTTCCGCCGCAACGCTCGCCACATTCTGGGTCAGGTGAACCTT
GTGGCGGCTGGTACTCGGGTGTCTATCCACGGCCCGCACTTCGCACCGTACCGGTACCTAACTTTTTGCCCCTTC
TTCGGGTTGCATCCAGCGGCAGAGGCCGGAGGTAGAAAACCCTCCCCCCCCCGGGCCTGCTTCCGCGCCTTTCCC
TCCCTCTCCAACCTACGCCGCTTTCTTCTCCGCCCTACCCCGAGTCTCCCCCCTTCGAAGTGCGACGCGGCTCCC
ATCGCGGCCTTGCCTCCCTCTCCCTCATATCGTCGTCGTCGTCGTCGCTTTCCCGCAATGTCGAACCAGGAGTAC
TACGGTGGCGGTGGCTACCCGCAGCATCCCCAACCTAGTTACGGACCACCGCAAGGGAACTATGGCCCTCCCCAG
GGATACAATGGCGGCTATCAACAAGGCCAGCCCCCGATGCAGTACCAGCAGGCCCCTCCCCCCAATGAATCCCGC
GGCCGCCGCGGTGGCAGCAACAATTGCTTAATGGCCTGTCTGGCCGCGCTCTGCTGCTGCTGCGTCGCCGAAGAG
GGTTGCGAATGCTGCCTCGAGTGTTGCGAGTGCCTCTGTTAA
Transcript >Ophio5|3798
ATGGAATATAAAGGCGTTGCACGGCCAGCCATCGGAGCGTTGGATACCGCCCCAATAAAACGACCTGCCCAACCG
CGAAGGCAACCTACATCTCGGCCTTGTTTCTTCACTCTCTCTCTCCCCCTCTCTCTCTCAGGGGTTTTTTTTTTT
GGCGGTTCCGTGATCAAAGACTTGCAGCCCGGCAACTCGGCATCTCCAGGCGCCAGCCATTCTCCGAAGGGTCGG
TTTTCCCCCTCCCCTCCCTACCTAGCCCGCTTCTTCCGCCGCAACGCTCGCCACATTCTGGGTCAGGTGAACCTT
GTGGCGGCTGGTACTCGGGTGTCTATCCACGGCCCGCACTTCGCACCGTACCGGTACCTAACTTTTTGCCCCTTC
TTCGGGTTGCATCCAGCGGCAGAGGCCGGAGGTAGAAAACCCTCCCCCCCCCGGGCCTGCTTCCGCGCCTTTCCC
TCCCTCTCCAACCTACGCCGCTTTCTTCTCCGCCCTACCCCGAGTCTCCCCCCTTCGAAGTGCGACGCGGCTCCC
ATCGCGGCCTTGCCTCCCTCTCCCTCATATCGTCGTCGTCGTCGTCGCTTTCCCGCAATGTCGAACCAGGAGTAC
TACGGTGGCGGTGGCTACCCGCAGCATCCCCAACCTAGTTACGGACCACCGCAAGGGAACTATGGCCCTCCCCAG
GGATACAATGGCGGCTATCAACAAGGCCAGCCCCCGATGCAGTACCAGCAGGCCCCTCCCCCCAATGAATCCCGC
GGCCGCCGCGGTGGCAGCAACAATTGCTTAATGGCCTGTCTGGCCGCGCTCTGCTGCTGCTGCGTCGCCGAAGAG
GGTTGCGAATGCTGCCTCGAGTGTTGCGAGTGCCTCTGTTAA
Gene >Ophio5|3798
ATGGAATATAAAGGCGTTGCACGGCCAGCCATCGGAGCGTTGGATACCGCCCCAATAAAACGACCTGCCCAACCG
CGAAGGCAACCTACATCTCGGCCTTGTTTCTTCACTCTCTCTCTCCCCCTCTCTCTCTCAGGGGTTTTTTTTTTT
GGCGGTTCCGTGATCAAAGGTTTGCAACCGTACTTACTCCCCCTACCACGTACATACTACCTACATATGTAGGTA
GGTAGGTAGCTGACGACGTTCTCCAGACTTGCAGCCCGGCAACTCGGCATCTCCAGGCGCCAGCCGTAAGCACTG
AATAGTGGAGTGGGGGCGGCCCCGAGCTAATTGGCTGGAACCTTTCCGGTATACAGATTCTCCGAAGGGTCGGTT
TTCCCCCTCCCCTCCCTACCTAGGTAGGTGGGTAAGTGGCCTGTCTCACCAGATTTTCCCTCTCTCTTCTTTTCC
CACTTGTCTCTCTCGGCGGCGACTCCGTGGCCCATTTGCATACAAAAAGCATAGGTGGGTGCCGATACATCGACA
TCGGCACCGTGATTGGCCGGCCTGTCTCAAGTCGCAACTTGCACAGCCTCCCGCGCGTACGCAAGCAACTTTCCC
ATCTTGTCTCTTCTTACACCCTTTCTGGCTCCCGACGACACACCAGCTTTTTTTGCACAGCCCGCTTCTTCCGCC
GCAACGCTCGCCACATTCTGGGTCAGGTGAACCTTGTGGCGGCTGGTACCGATTACTTACCTAGGTATATATCCC
TCTTTTCGACTCGCTAGGTACGAATAGGTACTCGGGTGTCTATCCACGGCCCGCACTTCGCACCGTACCGGTACC
TAACTTTTTGCCCCTTCTTCGGGTTGCATCCAGCGGCAGAGGCCGGGTACGTAGCCGACTCAAGGTAAAACGACC
AGAGAAGTTAACCTCGCCTCAGAGGTAGAAAACCCTCCCCCCCCCGGGCCTGCTTCCGCGCCTTTCCCTCCCTCT
CCAACCTACGCCGCTTTCTTCTCCGCCCTACCCCGAGTCTCCCCCCTTCGAAGTGCGACGCGGCTCCCATCGCGG
CCTTGCCTCCCTCTCCCTCATATCGTCGTCGTCGTCGTCGCTTTCCCGCAATGTCGAACCAGGAGTACTACGGTG
GCGGTGGCTACCCGCAGCATCCCCAACCTGTAAGCCGCCTAGCTGTGTGTCGACGATGGTGATGCTGCGTCGTCA
TCGTCGTCATTCTGGTCATCAGCACCAGCATCGTTGCCATCGCCGAAACCTCGCTGCCGAATGTAGCGGGGAATT
ACCAGAGGAATGCGCTCGCTGACCCGGATCTGCTTCCCATTTTTCCAGAGTTACGGACCACCGCAAGGGAACTAT
GGCCCTCCCCAGGGATACAATGGCGGCTATCAACAAGGCCAGCCCCCGATGCAGTACCAGCAGGCCCCTCCCCCC
AATGAATCCCGCGGCCGCCGCGGTGGCAGCAACAATTGCTTAATGGCCTGTCTGGCCGCGCTCTGCTGCTGCTGC
GTCGCCGAAGAGGGTTGCGAATGCTGGTACGTCTCGATTACACTCATCCACTACCATCGCACTCCATCGCGGAAA
AGCCAGATTGACTGAATATCTTTCCAAAGCCTCGAGTGTTGCGAGTGCCTCTGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail