Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3794
Gene name
Locationscaffold_3:18675..19652
Strand-
Gene length (bp)977
Transcript length (bp)924
Coding sequence length (bp)921
Protein length (aa) 307

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01553 Acyltransferase Acyltransferase 5.4E-12 70 225
PF16076 Acyltransf_C Acyltransferase C-terminus 1.1E-07 253 289

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SYC8|LPAT3_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 OS=Arabidopsis thaliana GN=LPAT3 PE=2 SV=1 1 289 2.0E-29
sp|Q8LG50|LPAT2_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Arabidopsis thaliana GN=LPAT2 PE=1 SV=2 9 289 2.0E-27
sp|Q6UWP7|LCLT1_HUMAN Lysocardiolipin acyltransferase 1 OS=Homo sapiens GN=LCLAT1 PE=1 SV=1 25 290 7.0E-27
sp|Q9XFW4|LPAT2_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Brassica napus GN=LPAT2 PE=2 SV=1 9 289 2.0E-26
sp|Q6IWY1|LPAT2_BRAOL 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Brassica oleracea GN=LPAT2 PE=2 SV=1 12 289 3.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SYC8|LPAT3_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 OS=Arabidopsis thaliana GN=LPAT3 PE=2 SV=1 1 289 2.0E-29
sp|Q8LG50|LPAT2_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Arabidopsis thaliana GN=LPAT2 PE=1 SV=2 9 289 2.0E-27
sp|Q6UWP7|LCLT1_HUMAN Lysocardiolipin acyltransferase 1 OS=Homo sapiens GN=LCLAT1 PE=1 SV=1 25 290 7.0E-27
sp|Q9XFW4|LPAT2_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Brassica napus GN=LPAT2 PE=2 SV=1 9 289 2.0E-26
sp|Q6IWY1|LPAT2_BRAOL 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Brassica oleracea GN=LPAT2 PE=2 SV=1 12 289 3.0E-26
sp|O94361|YHOE_SCHPO Uncharacterized acyltransferase C428.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.14 PE=3 SV=1 78 290 9.0E-26
sp|Q8L4Y2|LPAT4_ARATH Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 4 OS=Arabidopsis thaliana GN=LPAT4 PE=2 SV=1 7 294 1.0E-25
sp|Q9LHN4|LPAT5_ARATH Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5 OS=Arabidopsis thaliana GN=LPAT5 PE=2 SV=1 59 289 3.0E-25
sp|Q5F3X0|LCLT1_CHICK Lysocardiolipin acyltransferase 1 OS=Gallus gallus GN=LCLAT1 PE=2 SV=1 8 288 3.0E-25
sp|Q9NRZ5|PLCD_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Homo sapiens GN=AGPAT4 PE=1 SV=1 21 289 4.0E-25
sp|Q5R757|PLCD_PONAB 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Pongo abelii GN=AGPAT4 PE=2 SV=1 21 289 4.0E-25
sp|Q5E9R2|PLCD_BOVIN 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Bos taurus GN=AGPAT4 PE=2 SV=1 20 307 6.0E-25
sp|Q3UN02|LCLT1_MOUSE Lysocardiolipin acyltransferase 1 OS=Mus musculus GN=Lclat1 PE=1 SV=2 16 290 1.0E-24
sp|Q4R581|PLCD_MACFA 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Macaca fascicularis GN=AGPAT4 PE=2 SV=1 21 289 3.0E-24
sp|Q8K4X7|PLCD_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Mus musculus GN=Agpat4 PE=1 SV=1 21 289 9.0E-24
sp|Q924S1|PLCD_RAT 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Rattus norvegicus GN=Agpat4 PE=2 SV=1 17 289 1.0E-23
sp|Q6NYV8|LCLT1_DANRE Lysocardiolipin acyltransferase 1 OS=Danio rerio GN=lclat1 PE=1 SV=1 59 289 6.0E-23
sp|Q9D517|PLCC_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Mus musculus GN=Agpat3 PE=1 SV=2 31 307 8.0E-22
sp|Q5RA57|PLCC_PONAB 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Pongo abelii GN=AGPAT3 PE=2 SV=1 21 307 3.0E-21
sp|Q9NRZ7|PLCC_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Homo sapiens GN=AGPAT3 PE=1 SV=1 21 307 3.0E-21
sp|Q9D1E8|PLCE_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon OS=Mus musculus GN=Agpat5 PE=2 SV=2 26 281 4.0E-21
sp|Q41745|LPAT_MAIZE 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 OS=Zea mays GN=PLS1 PE=2 SV=1 29 289 4.0E-21
sp|Q9NUQ2|PLCE_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon OS=Homo sapiens GN=AGPAT5 PE=1 SV=3 60 288 8.0E-19
sp|Q12185|YD018_YEAST Uncharacterized acyltransferase YDR018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR018C PE=3 SV=1 71 289 4.0E-18
sp|P32129|YIHG_ECOLI Probable acyltransferase YihG OS=Escherichia coli (strain K12) GN=yihG PE=1 SV=1 82 230 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 117 136 19
3 146 165 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3794
MKIVTHLRGVAVTSPWLLHLLLADIVLSLLLPLRPLAPRIVYNVSSRIAESVWGWIQTIFERINGAHIVCSGDAL
PLGESAIIVVNHVAWADFYMIQALARRAAMLGRCRYFVKRQLRMVPFLGWGLWAIGMPMVSRNWIKDEEELAHVF
SGIVNCGFPTWLISFSEATRFSKSKYDESRAWCKKVDKPQPMHLLYPRTKGFIATVQHLRKAPHIKAVYDLSISY
QHKNRFQSAPTMWETLSVPQLSPRHGFKFHVHARRFPIESLPDTDDGLACWLEERWLEKGEWLEARRKQWLAQAD
TVSPSER
Coding >Ophio5|3794
ATGAAGATCGTCACTCACCTCCGGGGCGTCGCCGTGACCTCGCCCTGGCTGTTGCACCTCTTGCTGGCCGACATC
GTCCTGTCTCTGCTTCTGCCGCTGCGTCCGTTGGCTCCGCGGATCGTGTACAACGTCTCGTCACGTATTGCCGAA
TCCGTCTGGGGATGGATTCAGACCATCTTTGAGCGCATCAATGGCGCACACATTGTCTGCTCGGGCGACGCTCTG
CCACTTGGCGAGTCGGCCATCATCGTCGTTAATCATGTCGCCTGGGCCGACTTCTACATGATTCAGGCCCTCGCC
CGGCGAGCCGCGATGCTGGGGCGCTGTCGCTACTTCGTCAAGCGCCAGCTGCGAATGGTTCCTTTCCTCGGATGG
GGCCTCTGGGCTATCGGCATGCCCATGGTGAGCCGCAATTGGATCAAAGACGAGGAGGAGCTCGCCCACGTCTTT
TCGGGCATCGTCAATTGCGGCTTTCCCACGTGGCTCATCAGCTTCAGCGAGGCGACCAGATTCAGCAAGAGCAAG
TACGACGAGTCCCGGGCATGGTGCAAGAAGGTGGACAAGCCGCAGCCGATGCACCTGCTGTACCCGCGCACCAAG
GGCTTCATCGCTACAGTCCAGCATCTGCGGAAGGCACCACACATCAAGGCCGTGTACGACCTCAGCATCTCCTAC
CAGCACAAGAACAGGTTTCAGTCGGCGCCCACGATGTGGGAGACGCTGAGCGTGCCGCAGCTGAGCCCTCGACAC
GGCTTCAAATTTCACGTCCACGCGCGCCGATTCCCGATCGAGTCTCTCCCAGACACGGATGATGGACTAGCGTGC
TGGCTGGAGGAGCGATGGCTCGAGAAGGGAGAATGGCTGGAGGCGAGGAGGAAGCAGTGGCTGGCCCAGGCCGAT
ACGGTTTCGCCAAGCGAGAGG
Transcript >Ophio5|3794
ATGAAGATCGTCACTCACCTCCGGGGCGTCGCCGTGACCTCGCCCTGGCTGTTGCACCTCTTGCTGGCCGACATC
GTCCTGTCTCTGCTTCTGCCGCTGCGTCCGTTGGCTCCGCGGATCGTGTACAACGTCTCGTCACGTATTGCCGAA
TCCGTCTGGGGATGGATTCAGACCATCTTTGAGCGCATCAATGGCGCACACATTGTCTGCTCGGGCGACGCTCTG
CCACTTGGCGAGTCGGCCATCATCGTCGTTAATCATGTCGCCTGGGCCGACTTCTACATGATTCAGGCCCTCGCC
CGGCGAGCCGCGATGCTGGGGCGCTGTCGCTACTTCGTCAAGCGCCAGCTGCGAATGGTTCCTTTCCTCGGATGG
GGCCTCTGGGCTATCGGCATGCCCATGGTGAGCCGCAATTGGATCAAAGACGAGGAGGAGCTCGCCCACGTCTTT
TCGGGCATCGTCAATTGCGGCTTTCCCACGTGGCTCATCAGCTTCAGCGAGGCGACCAGATTCAGCAAGAGCAAG
TACGACGAGTCCCGGGCATGGTGCAAGAAGGTGGACAAGCCGCAGCCGATGCACCTGCTGTACCCGCGCACCAAG
GGCTTCATCGCTACAGTCCAGCATCTGCGGAAGGCACCACACATCAAGGCCGTGTACGACCTCAGCATCTCCTAC
CAGCACAAGAACAGGTTTCAGTCGGCGCCCACGATGTGGGAGACGCTGAGCGTGCCGCAGCTGAGCCCTCGACAC
GGCTTCAAATTTCACGTCCACGCGCGCCGATTCCCGATCGAGTCTCTCCCAGACACGGATGATGGACTAGCGTGC
TGGCTGGAGGAGCGATGGCTCGAGAAGGGAGAATGGCTGGAGGCGAGGAGGAAGCAGTGGCTGGCCCAGGCCGAT
ACGGTTTCGCCAAGCGAGAGGTAG
Gene >Ophio5|3794
ATGAAGATCGTCACTCACCTCCGGGGCGTCGCCGTGACCTCGCCCTGGCTGTTGCACCTCTTGCTGGCCGACATC
GTCCTGTCTCTGCTTCTGCCGCTGCGTCCGTTGGCTCCGCGGATCGTGTACAACGTCTCGTCACGTATTGCCGAA
TCCGTCTGGGGATGGATTCAGACCATCTTTGAGCGCATCAATGGCGCACACATTGTCTGCTCGGGCGACGCTCTG
CCACTTGGCGAGTCGGCCATCATCGTCGTTAATCATGTCGCCTGGGCCGACTTCTACATGATTCAGGCCCTCGCC
CGGCGAGCCGCGATGCTGGGGCGCTGTCGCTACTTCGTCAAGCGCCAGCTGCGAATGGTTCCTTTCCTCGGATGG
GGCCTCTGGGCTATCGGCATGCCCATGGTGAGCCGCAATTGGATCAAAGACGAGGAGGAGCTCGCCCACGTCTTT
TCGGGCATCGTCAATTGCGGCTTTCCCACGTGTGAGTGACGCTTCGGACCGATTCGCGAACAGCTGTCTAAGATG
ATGCCACAGGGCTCATCAGCTTCAGCGAGGCGACCAGATTCAGCAAGAGCAAGTACGACGAGTCCCGGGCATGGT
GCAAGAAGGTGGACAAGCCGCAGCCGATGCACCTGCTGTACCCGCGCACCAAGGGCTTCATCGCTACAGTCCAGC
ATCTGCGGAAGGCACCACACATCAAGGCCGTGTACGACCTCAGCATCTCCTACCAGCACAAGAACAGGTTTCAGT
CGGCGCCCACGATGTGGGAGACGCTGAGCGTGCCGCAGCTGAGCCCTCGACACGGCTTCAAATTTCACGTCCACG
CGCGCCGATTCCCGATCGAGTCTCTCCCAGACACGGATGATGGACTAGCGTGCTGGCTGGAGGAGCGATGGCTCG
AGAAGGGAGAATGGCTGGAGGCGAGGAGGAAGCAGTGGCTGGCCCAGGCCGATACGGTTTCGCCAAGCGAGAGGT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail