Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3793
Gene name
Locationscaffold_3:10843..16679
Strand-
Gene length (bp)5836
Transcript length (bp)5775
Coding sequence length (bp)5772
Protein length (aa) 1924

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.5E-37 730 877
PF00069 Pkinase Protein kinase domain 1.6E-20 1039 1136
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.5E-20 730 877
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.4E-05 1049 1132
PF00072 Response_reg Response regulator receiver domain 3.8E-15 1521 1630
PF03109 ABC1 ABC1 atypical kinase-like domain 3.7E-05 790 876

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38938|CEK1_SCHPO Serine/threonine-protein kinase cek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cek1 PE=1 SV=3 666 1294 2.0E-134
sp|P43565|RIM15_YEAST Serine/threonine-protein kinase RIM15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM15 PE=1 SV=1 666 1198 9.0E-115
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 663 885 1.0E-65
sp|Q552E9|PKGA_DICDI Probable serine/threonine-protein kinase pkgA OS=Dictyostelium discoideum GN=pkgA PE=3 SV=1 702 883 2.0E-54
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 710 881 2.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38938|CEK1_SCHPO Serine/threonine-protein kinase cek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cek1 PE=1 SV=3 666 1294 2.0E-134
sp|P43565|RIM15_YEAST Serine/threonine-protein kinase RIM15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM15 PE=1 SV=1 666 1198 9.0E-115
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 663 885 1.0E-65
sp|Q552E9|PKGA_DICDI Probable serine/threonine-protein kinase pkgA OS=Dictyostelium discoideum GN=pkgA PE=3 SV=1 702 883 2.0E-54
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 710 881 2.0E-54
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 695 918 1.0E-53
sp|Q559T8|Y0701_DICDI Probable serine/threonine-protein kinase DDB_G0272282 OS=Dictyostelium discoideum GN=DDB_G0272282 PE=3 SV=1 726 934 3.0E-52
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 1015 1284 3.0E-50
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 689 881 2.0E-48
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 725 931 3.0E-48
sp|B1WAR9|GWL_XENTR Serine/threonine-protein kinase greatwall OS=Xenopus tropicalis GN=mastl PE=2 SV=1 717 943 2.0E-46
sp|Q6NTJ3|GWL_XENLA Serine/threonine-protein kinase greatwall OS=Xenopus laevis GN=mastl PE=1 SV=1 717 943 2.0E-46
sp|Q6DBX4|GWL_DANRE Serine/threonine-protein kinase greatwall OS=Danio rerio GN=mastl PE=2 SV=1 724 900 3.0E-45
sp|Q8C0P0|GWL_MOUSE Serine/threonine-protein kinase greatwall OS=Mus musculus GN=Mastl PE=2 SV=2 717 900 9.0E-45
sp|Q05999|D6KL3_ARATH Serine/threonine-protein kinase D6PKL3 OS=Arabidopsis thaliana GN=D6PKL3 PE=1 SV=1 727 1178 1.0E-44
sp|E1C2I2|GWL_CHICK Serine/threonine-protein kinase greatwall OS=Gallus gallus GN=MASTL PE=3 SV=1 719 952 1.0E-44
sp|D2HXI8|GWL_AILME Serine/threonine-protein kinase greatwall OS=Ailuropoda melanoleuca GN=MASTL PE=3 SV=1 717 900 2.0E-44
sp|E2RJI4|GWL_CANLF Serine/threonine-protein kinase greatwall OS=Canis lupus familiaris GN=MASTL PE=3 SV=1 717 879 2.0E-44
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 718 880 4.0E-44
sp|E1BFR5|GWL_BOVIN Serine/threonine-protein kinase greatwall OS=Bos taurus GN=MASTL PE=3 SV=1 717 921 8.0E-44
sp|Q96GX5|GWL_HUMAN Serine/threonine-protein kinase greatwall OS=Homo sapiens GN=MASTL PE=1 SV=1 721 900 1.0E-43
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 719 880 1.0E-43
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 697 880 1.0E-42
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 706 881 1.0E-42
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 704 880 2.0E-42
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 723 880 9.0E-42
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 723 880 1.0E-41
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 724 880 2.0E-41
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 724 880 3.0E-41
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 724 880 3.0E-41
sp|Q64FQ2|PID2_ARATH Protein kinase PINOID 2 OS=Arabidopsis thaliana GN=PID2 PE=1 SV=1 726 1180 4.0E-40
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 50 448 1.0E-37
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 726 875 2.0E-37
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 706 880 3.0E-37
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 726 875 4.0E-37
sp|Q5AP53|CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBK1 PE=1 SV=1 725 875 7.0E-37
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 720 875 9.0E-37
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 726 874 9.0E-37
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 726 874 1.0E-36
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 726 874 1.0E-36
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 726 874 1.0E-36
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 1046 1291 3.0E-36
sp|O94324|PPK31_SCHPO Serine/threonine-protein kinase ppk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk31 PE=1 SV=1 725 875 3.0E-36
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 1040 1185 5.0E-36
sp|Q8BYR2|LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus GN=Lats1 PE=1 SV=3 729 874 5.0E-36
sp|Q754N7|CBK1_ASHGO Serine/threonine-protein kinase CBK1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBK1 PE=3 SV=1 727 875 5.0E-36
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 725 879 5.0E-36
sp|P53894|CBK1_YEAST Serine/threonine-protein kinase CBK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBK1 PE=1 SV=1 727 875 8.0E-36
sp|Q6CFS5|CBK1_YARLI Serine/threonine-protein kinase CBK1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBK1 PE=3 SV=1 676 875 8.0E-36
sp|P31034|CBK1_KLULA Serine/threonine-protein kinase CBK1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBK1 PE=3 SV=2 728 875 1.0E-35
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 729 874 1.0E-35
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 729 874 1.0E-35
sp|Q6FP74|CBK1_CANGA Serine/threonine-protein kinase CBK1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBK1 PE=3 SV=1 727 875 3.0E-35
sp|Q6TGC6|CBK1_PNECA Serine/threonine-protein kinase CBK1 OS=Pneumocystis carinii GN=CBK1 PE=2 SV=1 720 879 3.0E-35
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 726 874 4.0E-35
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 726 874 5.0E-35
sp|Q7TSJ6|LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus GN=Lats2 PE=1 SV=1 729 875 1.0E-34
sp|P38679|COT1_NEUCR Serine/threonine-protein kinase cot-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-1 PE=2 SV=2 727 875 2.0E-34
sp|Q9NRM7|LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens GN=LATS2 PE=1 SV=2 729 875 2.0E-34
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 713 876 3.0E-34
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 1043 1280 6.0E-34
sp|Q54HD2|NDRD_DICDI Probable serine/threonine-protein kinase ndrD OS=Dictyostelium discoideum GN=ndrD PE=3 SV=1 728 885 8.0E-34
sp|O13310|ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orb6 PE=1 SV=1 720 875 3.0E-33
sp|Q1ZXI5|Y1558_DICDI Probable serine/threonine-protein kinase DDB_G0278845 OS=Dictyostelium discoideum GN=DDB_G0278845 PE=3 SV=1 698 876 3.0E-33
sp|O45797|WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans GN=wts-1 PE=1 SV=1 729 875 5.0E-33
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=1 SV=2 728 899 7.0E-33
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 728 899 7.0E-33
sp|Q559T8|Y0701_DICDI Probable serine/threonine-protein kinase DDB_G0272282 OS=Dictyostelium discoideum GN=DDB_G0272282 PE=3 SV=1 965 1200 8.0E-33
sp|Q09013|DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens GN=DMPK PE=1 SV=3 728 899 8.0E-33
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 1046 1236 1.0E-32
sp|Q54Y26|NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum GN=ndrA PE=3 SV=1 728 874 1.0E-32
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 727 899 1.0E-32
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 727 899 2.0E-32
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 727 881 2.0E-32
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 725 874 3.0E-32
sp|P54265|DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus GN=Dmpk PE=1 SV=1 728 899 3.0E-32
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 725 874 3.0E-32
sp|Q54P47|NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum GN=ndrC PE=3 SV=1 726 882 6.0E-32
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 727 899 7.0E-32
sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 720 899 9.0E-32
sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 720 899 1.0E-31
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 720 899 1.0E-31
sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 720 899 1.0E-31
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 720 899 2.0E-31
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 727 882 2.0E-31
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 693 884 2.0E-31
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 726 876 3.0E-31
sp|P43565|RIM15_YEAST Serine/threonine-protein kinase RIM15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM15 PE=1 SV=1 39 443 4.0E-31
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 720 899 4.0E-31
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 720 899 4.0E-31
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 720 899 5.0E-31
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 720 899 6.0E-31
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 728 873 2.0E-30
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 705 899 2.0E-30
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 727 899 3.0E-30
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 729 901 4.0E-30
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 728 907 4.0E-30
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 727 899 5.0E-30
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 727 899 5.0E-30
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 708 899 9.0E-30
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 728 876 9.0E-30
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 726 899 1.0E-29
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 711 886 1.0E-29
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 725 946 1.0E-29
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 718 880 1.0E-29
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 726 902 1.0E-29
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 701 876 2.0E-29
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 728 907 2.0E-29
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 726 902 2.0E-29
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 660 907 2.0E-29
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 729 874 2.0E-29
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 722 908 3.0E-29
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 723 899 3.0E-29
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 725 876 3.0E-29
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 722 876 3.0E-29
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 727 879 3.0E-29
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 675 875 3.0E-29
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 729 876 4.0E-29
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 722 908 4.0E-29
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 729 876 4.0E-29
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 711 876 4.0E-29
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 711 876 4.0E-29
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 726 902 4.0E-29
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 721 876 5.0E-29
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 729 876 5.0E-29
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 726 908 6.0E-29
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 699 886 6.0E-29
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 725 879 7.0E-29
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 720 899 8.0E-29
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 721 876 8.0E-29
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 719 876 8.0E-29
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 719 876 8.0E-29
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 719 876 8.0E-29
sp|Q59KM8|DBF2_CANAL Cell cycle protein kinase DBF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBF2 PE=2 SV=1 720 875 8.0E-29
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 717 876 9.0E-29
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 721 876 9.0E-29
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 722 908 1.0E-28
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 703 905 1.0E-28
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 707 876 2.0E-28
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 726 902 2.0E-28
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 725 876 2.0E-28
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 715 908 2.0E-28
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 722 876 2.0E-28
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 715 907 2.0E-28
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 719 876 2.0E-28
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 719 876 3.0E-28
sp|O62846|KAPCG_MACMU cAMP-dependent protein kinase catalytic subunit gamma (Fragment) OS=Macaca mulatta GN=PRKACG PE=2 SV=3 721 876 3.0E-28
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 704 910 3.0E-28
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 704 910 3.0E-28
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 726 876 3.0E-28
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 725 899 3.0E-28
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 729 876 3.0E-28
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 726 908 3.0E-28
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 727 876 3.0E-28
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 719 899 4.0E-28
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 728 876 4.0E-28
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 721 876 4.0E-28
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 710 908 5.0E-28
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 720 873 6.0E-28
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 696 907 7.0E-28
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 696 907 7.0E-28
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 725 876 8.0E-28
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 720 904 9.0E-28
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 726 908 1.0E-27
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 710 888 1.0E-27
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 722 899 1.0E-27
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 726 908 1.0E-27
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 726 908 1.0E-27
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 729 876 2.0E-27
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 729 876 2.0E-27
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 729 876 2.0E-27
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 729 876 2.0E-27
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 721 876 2.0E-27
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 726 908 2.0E-27
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 726 908 2.0E-27
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 722 876 2.0E-27
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 729 876 2.0E-27
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 707 876 2.0E-27
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 721 876 2.0E-27
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 722 886 2.0E-27
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 725 903 2.0E-27
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 725 912 2.0E-27
sp|P43565|RIM15_YEAST Serine/threonine-protein kinase RIM15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM15 PE=1 SV=1 1227 1636 3.0E-27
sp|Q6DBX4|GWL_DANRE Serine/threonine-protein kinase greatwall OS=Danio rerio GN=mastl PE=2 SV=1 1045 1187 3.0E-27
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 719 876 3.0E-27
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 728 908 3.0E-27
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 714 879 3.0E-27
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 709 899 3.0E-27
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 729 876 3.0E-27
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 713 907 3.0E-27
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 717 907 3.0E-27
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 719 876 3.0E-27
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 692 876 4.0E-27
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 719 876 4.0E-27
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 710 888 4.0E-27
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 709 879 5.0E-27
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk22 PE=1 SV=1 729 876 5.0E-27
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 726 899 5.0E-27
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 677 907 5.0E-27
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 726 899 6.0E-27
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 691 879 6.0E-27
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 719 876 7.0E-27
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 725 877 8.0E-27
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 726 908 8.0E-27
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 726 908 9.0E-27
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 726 908 1.0E-26
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 726 908 1.0E-26
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 725 876 1.0E-26
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 700 908 1.0E-26
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 726 908 1.0E-26
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 683 879 1.0E-26
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 683 879 1.0E-26
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 721 876 1.0E-26
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 705 876 1.0E-26
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 726 876 2.0E-26
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 710 879 2.0E-26
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 710 879 2.0E-26
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 726 879 2.0E-26
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 725 912 2.0E-26
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 726 908 2.0E-26
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 690 875 2.0E-26
sp|P38938|CEK1_SCHPO Serine/threonine-protein kinase cek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cek1 PE=1 SV=3 49 443 3.0E-26
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 710 907 3.0E-26
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 729 876 3.0E-26
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 726 899 3.0E-26
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 710 879 4.0E-26
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 721 912 5.0E-26
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 721 912 5.0E-26
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 707 907 5.0E-26
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 707 907 5.0E-26
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 721 912 6.0E-26
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 721 912 6.0E-26
sp|Q54TW2|PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum GN=pdkA PE=3 SV=1 723 877 6.0E-26
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 707 907 6.0E-26
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 1042 1185 7.0E-26
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 721 912 7.0E-26
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 726 879 8.0E-26
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 726 879 8.0E-26
sp|E1C2I2|GWL_CHICK Serine/threonine-protein kinase greatwall OS=Gallus gallus GN=MASTL PE=3 SV=1 1044 1186 9.0E-26
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 707 907 9.0E-26
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 726 879 9.0E-26
sp|B1WAR9|GWL_XENTR Serine/threonine-protein kinase greatwall OS=Xenopus tropicalis GN=mastl PE=2 SV=1 1039 1186 1.0E-25
sp|P21901|KAPL_APLCA Spermatozoon-associated protein kinase OS=Aplysia californica PE=2 SV=1 725 876 1.0E-25
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 726 879 1.0E-25
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 726 875 1.0E-25
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 719 886 1.0E-25
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 726 875 1.0E-25
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 726 912 1.0E-25
sp|Q09898|SID2_SCHPO Serine/threonine-protein kinase sid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid2 PE=1 SV=1 690 884 1.0E-25
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 720 899 1.0E-25
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 728 908 1.0E-25
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 728 873 1.0E-25
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 1042 1185 2.0E-25
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 726 879 2.0E-25
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 729 875 2.0E-25
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 703 899 2.0E-25
sp|Q86UX6|ST32C_HUMAN Serine/threonine-protein kinase 32C OS=Homo sapiens GN=STK32C PE=1 SV=1 729 899 2.0E-25
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 718 899 2.0E-25
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 728 899 2.0E-25
sp|E2RJI4|GWL_CANLF Serine/threonine-protein kinase greatwall OS=Canis lupus familiaris GN=MASTL PE=3 SV=1 1044 1186 3.0E-25
sp|E1BFR5|GWL_BOVIN Serine/threonine-protein kinase greatwall OS=Bos taurus GN=MASTL PE=3 SV=1 1044 1186 3.0E-25
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 1042 1185 3.0E-25
sp|Q8QZV4|ST32C_MOUSE Serine/threonine-protein kinase 32C OS=Mus musculus GN=Stk32c PE=1 SV=1 729 899 3.0E-25
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 729 875 3.0E-25
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 728 879 3.0E-25
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 1042 1185 4.0E-25
sp|A2YBX5|G11A_ORYSI Protein kinase G11A OS=Oryza sativa subsp. indica GN=OsI_021818 PE=2 SV=1 726 875 4.0E-25
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 717 876 4.0E-25
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 721 886 4.0E-25
sp|Q0DCT8|G11A_ORYSJ Protein kinase G11A OS=Oryza sativa subsp. japonica GN=Os06g0291600 PE=2 SV=1 726 875 5.0E-25
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 727 910 6.0E-25
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 1042 1185 7.0E-25
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 717 876 7.0E-25
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 717 907 7.0E-25
sp|Q8C0P0|GWL_MOUSE Serine/threonine-protein kinase greatwall OS=Mus musculus GN=Mastl PE=2 SV=2 1044 1186 8.0E-25
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 1042 1185 8.0E-25
sp|P0C1B1|CBK1_EMENI Serine/threonine-protein kinase cbk1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbk1 PE=3 SV=2 720 878 8.0E-25
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 1042 1185 9.0E-25
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 725 908 9.0E-25
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 727 910 9.0E-25
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 723 879 9.0E-25
sp|Q96GX5|GWL_HUMAN Serine/threonine-protein kinase greatwall OS=Homo sapiens GN=MASTL PE=1 SV=1 1044 1187 1.0E-24
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 1041 1206 1.0E-24
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 717 907 1.0E-24
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 683 876 1.0E-24
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 717 876 1.0E-24
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 683 876 1.0E-24
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 717 876 1.0E-24
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 725 877 1.0E-24
sp|Q6NTJ3|GWL_XENLA Serine/threonine-protein kinase greatwall OS=Xenopus laevis GN=mastl PE=1 SV=1 1039 1186 2.0E-24
sp|D2HXI8|GWL_AILME Serine/threonine-protein kinase greatwall OS=Ailuropoda melanoleuca GN=MASTL PE=3 SV=1 1044 1186 2.0E-24
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 718 899 2.0E-24
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 721 912 2.0E-24
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 717 876 2.0E-24
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 729 876 2.0E-24
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 725 883 2.0E-24
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 719 876 3.0E-24
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 725 883 3.0E-24
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 729 876 3.0E-24
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 1042 1206 4.0E-24
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 726 877 5.0E-24
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 722 883 5.0E-24
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 717 876 5.0E-24
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 722 883 5.0E-24
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 698 873 5.0E-24
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 1042 1185 6.0E-24
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 729 877 6.0E-24
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 722 883 6.0E-24
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 722 883 6.0E-24
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 729 877 7.0E-24
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 698 907 7.0E-24
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 717 876 9.0E-24
sp|Q1PFB9|AGC17_ARATH Serine/threonine-protein kinase AGC1-7 OS=Arabidopsis thaliana GN=AGC1-7 PE=1 SV=1 722 875 1.0E-23
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 726 876 1.0E-23
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 718 877 1.0E-23
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 726 879 2.0E-23
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 728 879 2.0E-23
sp|Q10364|SCK2_SCHPO Serine/threonine-protein kinase sck2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck2 PE=3 SV=1 728 879 2.0E-23
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 726 879 2.0E-23
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 726 900 2.0E-23
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 704 883 3.0E-23
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 1037 1183 4.0E-23
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 1037 1183 4.0E-23
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKC1 PE=1 SV=3 725 908 4.0E-23
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 1037 1183 5.0E-23
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 728 873 6.0E-23
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 720 876 6.0E-23
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 728 873 6.0E-23
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 1046 1192 7.0E-23
sp|Q9VWQ2|S6KL_DROME Serine/threonine-protein kinase S6KL OS=Drosophila melanogaster GN=S6KL PE=1 SV=1 729 908 7.0E-23
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 726 877 7.0E-23
sp|Q9JJX8|ST32B_MOUSE Serine/threonine-protein kinase 32B OS=Mus musculus GN=Stk32b PE=2 SV=2 729 884 7.0E-23
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 1046 1191 8.0E-23
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 725 876 8.0E-23
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 707 876 8.0E-23
sp|Q9NY57|ST32B_HUMAN Serine/threonine-protein kinase 32B OS=Homo sapiens GN=STK32B PE=2 SV=1 729 875 8.0E-23
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 725 876 9.0E-23
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 725 876 1.0E-22
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 729 889 1.0E-22
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 726 876 1.0E-22
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 708 877 1.0E-22
sp|Q39183|D6KL2_ARATH Serine/threonine-protein kinase D6PKL2 OS=Arabidopsis thaliana GN=D6PKL2 PE=1 SV=1 726 880 1.0E-22
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 1046 1192 2.0E-22
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 729 875 2.0E-22
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 722 876 2.0E-22
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 1037 1183 3.0E-22
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 1037 1183 3.0E-22
sp|F4I4F2|RHS3_ARATH Serine/threonine-protein kinase RHS3 OS=Arabidopsis thaliana GN=RHS3 PE=1 SV=1 720 875 3.0E-22
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 726 876 3.0E-22
sp|P32865|GPRK1_DROME G protein-coupled receptor kinase 1 OS=Drosophila melanogaster GN=Gprk1 PE=2 SV=2 723 875 3.0E-22
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 728 873 3.0E-22
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 729 883 4.0E-22
sp|Q9LFA2|KIPK_ARATH Serine/threonine-protein kinase KIPK OS=Arabidopsis thaliana GN=KIPK PE=1 SV=1 1045 1181 4.0E-22
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 726 876 4.0E-22
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 703 877 4.0E-22
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 1046 1184 5.0E-22
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 726 876 5.0E-22
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 729 877 6.0E-22
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 726 889 6.0E-22
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 701 875 6.0E-22
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 725 876 6.0E-22
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 726 875 7.0E-22
sp|Q9LTW5|AGC15_ARATH Serine/threonine-protein kinase AGC1-5 OS=Arabidopsis thaliana GN=AGC1-5 PE=1 SV=1 723 875 7.0E-22
sp|Q9LFA2|KIPK_ARATH Serine/threonine-protein kinase KIPK OS=Arabidopsis thaliana GN=KIPK PE=1 SV=1 726 875 8.0E-22
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 1046 1298 9.0E-22
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 679 899 9.0E-22
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 729 877 9.0E-22
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 1046 1298 1.0E-21
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 722 899 1.0E-21
sp|P53894|CBK1_YEAST Serine/threonine-protein kinase CBK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBK1 PE=1 SV=1 976 1182 2.0E-21
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 1045 1171 2.0E-21
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 1041 1183 2.0E-21
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 1041 1183 2.0E-21
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 1041 1183 2.0E-21
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 1041 1183 2.0E-21
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 1041 1183 2.0E-21
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 726 899 2.0E-21
sp|P16911|KDC1_DROME Protein kinase DC1 OS=Drosophila melanogaster GN=Pka-C2 PE=2 SV=1 735 907 2.0E-21
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 729 899 2.0E-21
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 718 877 2.0E-21
sp|Q9FG74|D6PK_ARATH Serine/threonine-protein kinase D6PK OS=Arabidopsis thaliana GN=D6PK PE=1 SV=1 726 901 2.0E-21
sp|Q54C18|Y9452_DICDI Probable serine/threonine-protein kinase DDB_G0293276 OS=Dictyostelium discoideum GN=DDB_G0293276 PE=3 SV=1 725 873 2.0E-21
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 729 877 2.0E-21
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 705 875 2.0E-21
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 713 875 2.0E-21
sp|Q6TGC6|CBK1_PNECA Serine/threonine-protein kinase CBK1 OS=Pneumocystis carinii GN=CBK1 PE=2 SV=1 1042 1183 3.0E-21
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 1046 1298 3.0E-21
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 1040 1211 3.0E-21
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 1040 1211 3.0E-21
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 1041 1183 3.0E-21
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 706 875 3.0E-21
sp|Q6P5Z2|PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo sapiens GN=PKN3 PE=1 SV=1 625 908 3.0E-21
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 725 909 3.0E-21
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 722 881 3.0E-21
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 1041 1183 4.0E-21
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 726 875 4.0E-21
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 729 875 4.0E-21
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 1046 1182 5.0E-21
sp|P15792|KPK1_PHAVU Protein kinase PVPK-1 OS=Phaseolus vulgaris PE=2 SV=1 726 875 5.0E-21
sp|P26818|ARBK2_BOVIN Beta-adrenergic receptor kinase 2 OS=Bos taurus GN=ADRBK2 PE=2 SV=1 725 875 5.0E-21
sp|Q64682|ARBK1_MESAU Beta-adrenergic receptor kinase 1 OS=Mesocricetus auratus GN=ADRBK1 PE=2 SV=1 725 875 5.0E-21
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 1041 1216 6.0E-21
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 726 877 6.0E-21
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 726 877 6.0E-21
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 726 889 6.0E-21
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 1040 1184 7.0E-21
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 1040 1211 7.0E-21
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 1040 1211 7.0E-21
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 1037 1183 7.0E-21
sp|Q09639|GRK2_CAEEL G protein-coupled receptor kinase 2 OS=Caenorhabditis elegans GN=grk-2 PE=3 SV=2 723 875 7.0E-21
sp|P25098|ARBK1_HUMAN Beta-adrenergic receptor kinase 1 OS=Homo sapiens GN=ADRBK1 PE=1 SV=2 725 875 7.0E-21
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 726 877 7.0E-21
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 1046 1202 8.0E-21
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 1041 1183 8.0E-21
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 1037 1183 8.0E-21
sp|Q99MK8|ARBK1_MOUSE Beta-adrenergic receptor kinase 1 OS=Mus musculus GN=Adrbk1 PE=1 SV=2 725 875 8.0E-21
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 729 875 8.0E-21
sp|P26817|ARBK1_RAT Beta-adrenergic receptor kinase 1 OS=Rattus norvegicus GN=Adrbk1 PE=1 SV=1 725 875 9.0E-21
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 1024 1183 1.0E-20
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 1041 1183 1.0E-20
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 1045 1184 1.0E-20
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 1039 1183 1.0E-20
sp|P21146|ARBK1_BOVIN Beta-adrenergic receptor kinase 1 OS=Bos taurus GN=ADRBK1 PE=1 SV=1 725 875 1.0E-20
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 726 876 1.0E-20
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 726 877 1.0E-20
sp|Q63433|PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus norvegicus GN=Pkn1 PE=1 SV=2 680 879 1.0E-20
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 729 877 1.0E-20
sp|O97627|ARBK1_DIDVI Beta-adrenergic receptor kinase 1 OS=Didelphis virginiana GN=ADRBK1 PE=1 SV=1 725 875 1.0E-20
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 725 879 1.0E-20
sp|Q6CFS5|CBK1_YARLI Serine/threonine-protein kinase CBK1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBK1 PE=3 SV=1 1042 1182 2.0E-20
sp|Q6FP74|CBK1_CANGA Serine/threonine-protein kinase CBK1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBK1 PE=3 SV=1 976 1182 2.0E-20
sp|Q54HD2|NDRD_DICDI Probable serine/threonine-protein kinase ndrD OS=Dictyostelium discoideum GN=ndrD PE=3 SV=1 1046 1307 2.0E-20
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 1045 1185 2.0E-20
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 1041 1216 2.0E-20
sp|Q39183|D6KL2_ARATH Serine/threonine-protein kinase D6PKL2 OS=Arabidopsis thaliana GN=D6PKL2 PE=1 SV=1 1045 1159 2.0E-20
sp|Q9LTW5|AGC15_ARATH Serine/threonine-protein kinase AGC1-5 OS=Arabidopsis thaliana GN=AGC1-5 PE=1 SV=1 1029 1202 2.0E-20
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 726 876 2.0E-20
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 726 877 2.0E-20
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 729 889 2.0E-20
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 722 883 2.0E-20
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 723 900 2.0E-20
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 726 912 2.0E-20
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 718 875 2.0E-20
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 1039 1183 3.0E-20
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 1041 1183 3.0E-20
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 1041 1183 3.0E-20
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 1041 1183 3.0E-20
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 1041 1216 3.0E-20
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 735 876 3.0E-20
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 729 875 3.0E-20
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 729 875 3.0E-20
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 726 876 3.0E-20
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 726 876 3.0E-20
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 726 912 4.0E-20
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 729 883 4.0E-20
sp|Q3UYH7|ARBK2_MOUSE Beta-adrenergic receptor kinase 2 OS=Mus musculus GN=Adrbk2 PE=1 SV=2 725 875 4.0E-20
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 729 877 4.0E-20
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 726 876 4.0E-20
sp|P26819|ARBK2_RAT Beta-adrenergic receptor kinase 2 OS=Rattus norvegicus GN=Adrbk2 PE=2 SV=1 725 875 4.0E-20
sp|P31034|CBK1_KLULA Serine/threonine-protein kinase CBK1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBK1 PE=3 SV=2 1046 1182 5.0E-20
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 1037 1183 5.0E-20
sp|P35626|ARBK2_HUMAN Beta-adrenergic receptor kinase 2 OS=Homo sapiens GN=ADRBK2 PE=1 SV=2 725 875 5.0E-20
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 710 875 5.0E-20
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 725 875 5.0E-20
sp|Q16513|PKN2_HUMAN Serine/threonine-protein kinase N2 OS=Homo sapiens GN=PKN2 PE=1 SV=1 723 879 5.0E-20
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 1043 1182 6.0E-20
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 1041 1183 6.0E-20
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 1041 1183 6.0E-20
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 720 886 6.0E-20
sp|Q9SUA3|D6KL1_ARATH Serine/threonine-protein kinase D6PKL1 OS=Arabidopsis thaliana GN=D6PKL1 PE=1 SV=1 726 875 6.0E-20
sp|A7MBL8|PKN2_DANRE Serine/threonine-protein kinase N2 OS=Danio rerio GN=pkn2 PE=2 SV=1 692 879 6.0E-20
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 726 877 6.0E-20
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 723 900 6.0E-20
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 1041 1183 7.0E-20
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 1045 1171 7.0E-20
sp|Q54C18|Y9452_DICDI Probable serine/threonine-protein kinase DDB_G0293276 OS=Dictyostelium discoideum GN=DDB_G0293276 PE=3 SV=1 1041 1175 7.0E-20
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 713 882 7.0E-20
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 655 875 8.0E-20
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 723 900 8.0E-20
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 718 875 8.0E-20
sp|Q2QM77|PID_ORYSJ Protein kinase PINOID OS=Oryza sativa subsp. japonica GN=PID PE=2 SV=1 727 875 8.0E-20
sp|A2YBX5|G11A_ORYSI Protein kinase G11A OS=Oryza sativa subsp. indica GN=OsI_021818 PE=2 SV=1 1045 1159 9.0E-20
sp|Q0DCT8|G11A_ORYSJ Protein kinase G11A OS=Oryza sativa subsp. japonica GN=Os06g0291600 PE=2 SV=1 1045 1159 9.0E-20
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 1014 1159 9.0E-20
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 722 904 9.0E-20
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 1037 1183 1.0E-19
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 1045 1182 1.0E-19
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 1041 1183 1.0E-19
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 1045 1183 1.0E-19
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 1045 1183 1.0E-19
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 712 875 1.0E-19
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 720 906 1.0E-19
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 704 880 1.0E-19
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 725 875 1.0E-19
sp|P70268|PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus GN=Pkn1 PE=1 SV=3 656 879 1.0E-19
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 697 883 1.0E-19
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 718 877 1.0E-19
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 723 900 1.0E-19
sp|O94324|PPK31_SCHPO Serine/threonine-protein kinase ppk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk31 PE=1 SV=1 1042 1183 2.0E-19
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 1036 1168 2.0E-19
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 1045 1184 2.0E-19
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 1047 1183 2.0E-19
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 1047 1183 2.0E-19
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 1047 1183 2.0E-19
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 1047 1183 2.0E-19
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 1047 1183 2.0E-19
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 1005 1159 2.0E-19
sp|Q9W0V1|PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4 716 890 2.0E-19
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 726 877 2.0E-19
sp|Q8K045|PKN3_MOUSE Serine/threonine-protein kinase N3 OS=Mus musculus GN=Pkn3 PE=1 SV=1 640 908 2.0E-19
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 723 875 2.0E-19
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 735 876 2.0E-19
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 723 900 2.0E-19
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 725 875 2.0E-19
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 723 900 2.0E-19
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 735 912 2.0E-19
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 725 875 2.0E-19
sp|Q9FJV0|M2K6_ARATH Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana GN=MKK6 PE=1 SV=1 727 875 2.0E-19
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 722 904 2.0E-19
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 726 889 2.0E-19
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 725 875 2.0E-19
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 725 900 2.0E-19
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 723 881 2.0E-19
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 1047 1183 3.0E-19
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 1047 1183 3.0E-19
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 1047 1183 3.0E-19
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 729 877 3.0E-19
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 726 877 3.0E-19
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 723 900 3.0E-19
sp|Q9C8M5|WAG1_ARATH Serine/threonine-protein kinase WAG1 OS=Arabidopsis thaliana GN=WAG1 PE=2 SV=1 1046 1159 3.0E-19
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 720 875 3.0E-19
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 723 900 3.0E-19
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 712 875 3.0E-19
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 1045 1184 4.0E-19
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 1045 1183 4.0E-19
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 723 900 4.0E-19
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 723 875 4.0E-19
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 729 877 4.0E-19
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 1045 1222 5.0E-19
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 717 877 5.0E-19
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 722 875 5.0E-19
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 726 877 5.0E-19
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 723 900 5.0E-19
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 685 893 5.0E-19
sp|P38679|COT1_NEUCR Serine/threonine-protein kinase cot-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-1 PE=2 SV=2 1046 1182 6.0E-19
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 1036 1174 6.0E-19
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 1045 1183 6.0E-19
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 1039 1160 6.0E-19
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 706 877 6.0E-19
sp|Q1ZXI5|Y1558_DICDI Probable serine/threonine-protein kinase DDB_G0278845 OS=Dictyostelium discoideum GN=DDB_G0278845 PE=3 SV=1 1046 1192 7.0E-19
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 1039 1183 7.0E-19
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 1028 1159 7.0E-19
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 729 912 7.0E-19
sp|O64682|PID_ARATH Protein kinase PINOID OS=Arabidopsis thaliana GN=PID PE=1 SV=1 725 875 7.0E-19
sp|Q9Y1J3|PDPK1_CAEEL 3-phosphoinositide-dependent protein kinase 1 OS=Caenorhabditis elegans GN=pdk-1 PE=1 SV=1 728 873 7.0E-19
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 1041 1216 8.0E-19
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 1041 1216 8.0E-19
sp|F4I4F2|RHS3_ARATH Serine/threonine-protein kinase RHS3 OS=Arabidopsis thaliana GN=RHS3 PE=1 SV=1 1045 1213 8.0E-19
sp|P32866|GPRK2_DROME G protein-coupled receptor kinase 2 OS=Drosophila melanogaster GN=Gprk2 PE=1 SV=3 722 902 8.0E-19
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 735 876 9.0E-19
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 735 920 9.0E-19
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 1046 1214 1.0E-18
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 1045 1183 1.0E-18
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 1046 1184 1.0E-18
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 1041 1216 1.0E-18
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 1047 1184 1.0E-18
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 1047 1183 1.0E-18
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 726 875 1.0E-18
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 726 875 1.0E-18
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 735 876 1.0E-18
sp|Q754N7|CBK1_ASHGO Serine/threonine-protein kinase CBK1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBK1 PE=3 SV=1 1046 1182 2.0E-18
sp|O13310|ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orb6 PE=1 SV=1 992 1182 2.0E-18
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 1045 1183 2.0E-18
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 1045 1183 2.0E-18
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 1045 1183 2.0E-18
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 1040 1183 2.0E-18
sp|Q1PFB9|AGC17_ARATH Serine/threonine-protein kinase AGC1-7 OS=Arabidopsis thaliana GN=AGC1-7 PE=1 SV=1 1029 1173 2.0E-18
sp|Q9FG74|D6PK_ARATH Serine/threonine-protein kinase D6PK OS=Arabidopsis thaliana GN=D6PK PE=1 SV=1 1045 1159 2.0E-18
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 726 875 2.0E-18
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 726 875 2.0E-18
sp|Q9Z335|SBK1_RAT Serine/threonine-protein kinase SBK1 OS=Rattus norvegicus GN=Sbk1 PE=1 SV=1 727 902 2.0E-18
sp|Q8QZX0|SBK1_MOUSE Serine/threonine-protein kinase SBK1 OS=Mus musculus GN=Sbk1 PE=2 SV=1 727 902 2.0E-18
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 726 889 2.0E-18
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 735 920 2.0E-18
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 723 877 2.0E-18
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 726 889 2.0E-18
sp|Q5AP53|CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBK1 PE=1 SV=1 1046 1182 3.0E-18
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 1032 1183 3.0E-18
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 1047 1183 3.0E-18
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 1047 1183 3.0E-18
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 1047 1183 3.0E-18
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 1037 1159 3.0E-18
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 1037 1159 3.0E-18
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 706 877 3.0E-18
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 712 877 3.0E-18
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=1 SV=2 1046 1184 4.0E-18
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 1047 1183 4.0E-18
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 1047 1183 4.0E-18
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 1047 1183 4.0E-18
sp|Q2QM77|PID_ORYSJ Protein kinase PINOID OS=Oryza sativa subsp. japonica GN=PID PE=2 SV=1 1045 1171 4.0E-18
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 729 881 4.0E-18
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 726 875 4.0E-18
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 725 892 4.0E-18
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 1046 1184 5.0E-18
sp|Q54P47|NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum GN=ndrC PE=3 SV=1 1046 1183 5.0E-18
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 1045 1184 5.0E-18
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 617 901 5.0E-18
sp|Q9SYB9|UNC_ARATH Serine/threonine-protein kinase UCN OS=Arabidopsis thaliana GN=UNC PE=1 SV=1 1045 1164 5.0E-18
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 727 912 5.0E-18
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 727 912 5.0E-18
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 1046 1214 6.0E-18
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 1045 1183 6.0E-18
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 1045 1184 6.0E-18
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 1045 1184 6.0E-18
sp|O64682|PID_ARATH Protein kinase PINOID OS=Arabidopsis thaliana GN=PID PE=1 SV=1 1045 1159 6.0E-18
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 718 877 6.0E-18
sp|Q52WX2|SBK1_HUMAN Serine/threonine-protein kinase SBK1 OS=Homo sapiens GN=SBK1 PE=2 SV=1 727 902 6.0E-18
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 729 875 6.0E-18
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 726 875 6.0E-18
sp|Q9LT38|UNCL_ARATH Serine/threonine-protein kinase UCNL OS=Arabidopsis thaliana GN=UCNL PE=2 SV=1 1019 1164 6.0E-18
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 729 875 6.0E-18
sp|Q15835|RK_HUMAN Rhodopsin kinase OS=Homo sapiens GN=GRK1 PE=1 SV=1 722 884 6.0E-18
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 1047 1183 7.0E-18
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 1045 1183 7.0E-18
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 1045 1184 7.0E-18
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 1040 1183 7.0E-18
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 725 875 7.0E-18
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 729 899 7.0E-18
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 713 875 7.0E-18
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 726 875 7.0E-18
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 1045 1184 8.0E-18
sp|Q8K045|PKN3_MOUSE Serine/threonine-protein kinase N3 OS=Mus musculus GN=Pkn3 PE=1 SV=1 1040 1184 8.0E-18
sp|P28327|RK_BOVIN Rhodopsin kinase OS=Bos taurus GN=GRK1 PE=1 SV=1 722 875 8.0E-18
sp|P34947|GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens GN=GRK5 PE=1 SV=1 723 897 8.0E-18
sp|P43249|GRK5_BOVIN G protein-coupled receptor kinase 5 OS=Bos taurus GN=GRK5 PE=1 SV=1 723 897 8.0E-18
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 689 877 8.0E-18
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 680 900 8.0E-18
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 1040 1162 9.0E-18
sp|Q9SUA3|D6KL1_ARATH Serine/threonine-protein kinase D6PKL1 OS=Arabidopsis thaliana GN=D6PKL1 PE=1 SV=1 1045 1159 9.0E-18
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 729 910 9.0E-18
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 729 899 9.0E-18
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 725 875 9.0E-18
sp|B0VXE8|CDK14_CALJA Cyclin-dependent kinase 14 OS=Callithrix jacchus GN=CDK14 PE=3 SV=1 729 876 9.0E-18
sp|Q8MYQ1|Y31E_CAEEL Putative serine/threonine-protein kinase F31E3.2 OS=Caenorhabditis elegans GN=F31E3.2 PE=3 SV=1 727 912 9.0E-18
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 685 877 9.0E-18
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 722 904 9.0E-18
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 726 877 9.0E-18
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 1043 1185 1.0E-17
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 1046 1183 1.0E-17
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 1046 1183 1.0E-17
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 1046 1213 1.0E-17
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 1047 1183 1.0E-17
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 1045 1215 1.0E-17
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 1045 1183 1.0E-17
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 1038 1187 1.0E-17
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 727 912 1.0E-17
sp|O94921|CDK14_HUMAN Cyclin-dependent kinase 14 OS=Homo sapiens GN=CDK14 PE=1 SV=3 729 876 1.0E-17
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 725 899 1.0E-17
sp|O35495|CDK14_MOUSE Cyclin-dependent kinase 14 OS=Mus musculus GN=Cdk14 PE=1 SV=2 729 876 1.0E-17
sp|Q49HM9|GRK7A_DANRE G-protein-coupled receptor kinase 7A OS=Danio rerio GN=grk7a PE=1 SV=2 723 907 1.0E-17
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 729 899 1.0E-17
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 726 876 1.0E-17
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 722 912 1.0E-17
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 702 877 1.0E-17
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 724 882 1.0E-17
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 722 904 1.0E-17
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 722 904 1.0E-17
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 702 877 1.0E-17
sp|Q94E49|PID2_ORYSJ Protein kinase PINOID 2 OS=Oryza sativa subsp. japonica GN=PID2 PE=2 SV=1 1042 1159 1.0E-17
sp|Q9LUL2|WAG2_ARATH Serine/threonine-protein kinase WAG2 OS=Arabidopsis thaliana GN=WAG2 PE=2 SV=1 1042 1226 1.0E-17
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 1046 1183 2.0E-17
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 1040 1179 2.0E-17
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 1045 1193 2.0E-17
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 1041 1179 3.0E-17
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 1040 1183 3.0E-17
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 1045 1183 3.0E-17
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 1040 1183 3.0E-17
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 1041 1185 3.0E-17
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 1045 1180 4.0E-17
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 1041 1183 4.0E-17
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 1045 1183 4.0E-17
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 1039 1163 4.0E-17
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 1041 1184 4.0E-17
sp|Q10364|SCK2_SCHPO Serine/threonine-protein kinase sck2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck2 PE=3 SV=1 1050 1211 4.0E-17
sp|Q16513|PKN2_HUMAN Serine/threonine-protein kinase N2 OS=Homo sapiens GN=PKN2 PE=1 SV=1 1040 1183 4.0E-17
sp|Q8BYR2|LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus GN=Lats1 PE=1 SV=3 1045 1183 5.0E-17
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 1045 1183 5.0E-17
sp|Q54Y26|NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum GN=ndrA PE=3 SV=1 1046 1183 5.0E-17
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 1045 1207 5.0E-17
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 1045 1183 5.0E-17
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 1041 1183 5.0E-17
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 1038 1187 5.0E-17
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 1038 1187 5.0E-17
sp|A7MBL8|PKN2_DANRE Serine/threonine-protein kinase N2 OS=Danio rerio GN=pkn2 PE=2 SV=1 1039 1183 5.0E-17
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 1040 1183 6.0E-17
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 1038 1187 7.0E-17
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 1038 1187 7.0E-17
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 1045 1183 8.0E-17
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 1038 1187 8.0E-17
sp|P15792|KPK1_PHAVU Protein kinase PVPK-1 OS=Phaseolus vulgaris PE=2 SV=1 1041 1159 8.0E-17
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 1045 1207 9.0E-17
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 1045 1184 9.0E-17
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 1045 1183 9.0E-17
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 1041 1160 1.0E-16
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 1045 1208 1.0E-16
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 1045 1183 1.0E-16
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 1040 1183 1.0E-16
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 1045 1185 1.0E-16
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 1038 1164 1.0E-16
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 1037 1183 2.0E-16
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 1040 1209 2.0E-16
sp|P0C1B1|CBK1_EMENI Serine/threonine-protein kinase cbk1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbk1 PE=3 SV=2 1022 1215 2.0E-16
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 1040 1183 2.0E-16
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 1041 1178 3.0E-16
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 1045 1184 3.0E-16
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 1045 1196 3.0E-16
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 1045 1185 3.0E-16
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 1045 1185 3.0E-16
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 1045 1185 3.0E-16
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 1045 1185 3.0E-16
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 1045 1185 3.0E-16
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk22 PE=1 SV=1 1045 1175 3.0E-16
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 1040 1167 3.0E-16
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 1045 1159 3.0E-16
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 1041 1183 3.0E-16
sp|Q6P5Z2|PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo sapiens GN=PKN3 PE=1 SV=1 1040 1184 3.0E-16
sp|Q09013|DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens GN=DMPK PE=1 SV=3 1046 1183 4.0E-16
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 1040 1181 4.0E-16
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 1041 1186 4.0E-16
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 1041 1168 4.0E-16
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 1041 1186 4.0E-16
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 1045 1159 4.0E-16
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 1046 1183 5.0E-16
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 1041 1186 5.0E-16
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 1045 1185 5.0E-16
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 1045 1183 6.0E-16
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 1041 1186 6.0E-16
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 1045 1183 6.0E-16
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 1041 1183 7.0E-16
sp|Q9W0V1|PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4 1045 1162 7.0E-16
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 1041 1183 9.0E-16
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 1045 1183 9.0E-16
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 1045 1183 9.0E-16
sp|Q9LT38|UNCL_ARATH Serine/threonine-protein kinase UCNL OS=Arabidopsis thaliana GN=UCNL PE=2 SV=1 732 876 9.0E-16
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 1041 1183 1.0E-15
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 1041 1183 1.0E-15
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 1041 1183 1.0E-15
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 1041 1183 1.0E-15
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 1041 1183 1.0E-15
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 1041 1183 1.0E-15
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 1041 1183 1.0E-15
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 1045 1160 1.0E-15
sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 1046 1183 2.0E-15
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 1045 1200 2.0E-15
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 1045 1183 2.0E-15
sp|P70268|PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus GN=Pkn1 PE=1 SV=3 1040 1183 2.0E-15
sp|Q9NRM7|LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens GN=LATS2 PE=1 SV=2 1045 1183 3.0E-15
sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 1046 1183 3.0E-15
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 1046 1183 3.0E-15
sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 1046 1183 3.0E-15
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 1045 1162 3.0E-15
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 1045 1162 3.0E-15
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 1041 1168 3.0E-15
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 1038 1167 3.0E-15
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 1046 1183 3.0E-15
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 1038 1180 3.0E-15
sp|Q63433|PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus norvegicus GN=Pkn1 PE=1 SV=2 1040 1183 3.0E-15
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 1039 1137 3.0E-15
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 1045 1176 4.0E-15
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 1047 1182 4.0E-15
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 1038 1185 4.0E-15
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 1045 1162 4.0E-15
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 1038 1180 4.0E-15
sp|O45797|WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans GN=wts-1 PE=1 SV=1 1029 1184 6.0E-15
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 1046 1199 6.0E-15
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 1038 1171 7.0E-15
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 1038 1171 7.0E-15
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 1046 1183 7.0E-15
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 1045 1162 7.0E-15
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 1038 1171 8.0E-15
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 1038 1171 8.0E-15
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 1041 1184 8.0E-15
sp|Q9LUL2|WAG2_ARATH Serine/threonine-protein kinase WAG2 OS=Arabidopsis thaliana GN=WAG2 PE=2 SV=1 726 875 8.0E-15
sp|Q94E49|PID2_ORYSJ Protein kinase PINOID 2 OS=Oryza sativa subsp. japonica GN=PID2 PE=2 SV=1 726 898 9.0E-15
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 1041 1168 1.0E-14
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 1047 1183 2.0E-14
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 1040 1183 2.0E-14
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 1046 1183 3.0E-14
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 1046 1183 3.0E-14
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 1046 1183 3.0E-14
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 1046 1183 3.0E-14
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 1036 1183 3.0E-14
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 1041 1183 3.0E-14
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 1041 1184 3.0E-14
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 1047 1173 3.0E-14
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 1041 1183 4.0E-14
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 1036 1160 4.0E-14
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 1045 1162 4.0E-14
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 1040 1183 4.0E-14
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 1045 1183 4.0E-14
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 1041 1168 5.0E-14
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 968 1183 6.0E-14
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 1045 1183 6.0E-14
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKC1 PE=1 SV=3 1045 1183 7.0E-14
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 968 1183 8.0E-14
sp|Q7TSJ6|LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus GN=Lats2 PE=1 SV=1 1045 1183 9.0E-14
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 968 1183 9.0E-14
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 1046 1183 1.0E-13
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 1046 1183 1.0E-13
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 1046 1183 1.0E-13
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 1045 1132 1.0E-13
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 1038 1162 2.0E-13
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 1045 1162 2.0E-13
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 1038 1171 2.0E-13
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 1041 1183 2.0E-13
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 1040 1202 2.0E-13
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 1038 1157 2.0E-13
sp|Q9C8M5|WAG1_ARATH Serine/threonine-protein kinase WAG1 OS=Arabidopsis thaliana GN=WAG1 PE=2 SV=1 726 874 3.0E-13
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 1047 1159 4.0E-13
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 1045 1132 4.0E-13
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 1035 1184 5.0E-13
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 1045 1184 7.0E-13
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 1046 1183 7.0E-13
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 1045 1133 7.0E-13
sp|Q54TW2|PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum GN=pdkA PE=3 SV=1 1042 1162 1.0E-12
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 1038 1133 1.0E-12
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 1045 1132 1.0E-12
sp|P54265|DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus GN=Dmpk PE=1 SV=1 1046 1223 2.0E-12
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 1046 1183 2.0E-12
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 733 877 2.0E-12
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 1038 1153 2.0E-12
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 733 876 3.0E-12
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 1034 1133 3.0E-12
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 1046 1147 3.0E-12
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 735 877 4.0E-12
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 1045 1133 5.0E-12
sp|P34947|GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens GN=GRK5 PE=1 SV=1 1040 1173 6.0E-12
sp|Q59KM8|DBF2_CANAL Cell cycle protein kinase DBF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBF2 PE=2 SV=1 1046 1183 8.0E-12
sp|P43249|GRK5_BOVIN G protein-coupled receptor kinase 5 OS=Bos taurus GN=GRK5 PE=1 SV=1 1040 1173 9.0E-12
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 1046 1183 1.0E-11
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 1046 1183 1.0E-11
sp|Q9SYB9|UNC_ARATH Serine/threonine-protein kinase UCN OS=Arabidopsis thaliana GN=UNC PE=1 SV=1 729 875 1.0E-11
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 660 912 2.0E-11
sp|P26819|ARBK2_RAT Beta-adrenergic receptor kinase 2 OS=Rattus norvegicus GN=Adrbk2 PE=2 SV=1 1046 1159 2.0E-11
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 1038 1133 2.0E-11
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 1034 1155 2.0E-11
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 1046 1183 3.0E-11
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 1045 1160 3.0E-11
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 1038 1133 3.0E-11
sp|Q9Y1J3|PDPK1_CAEEL 3-phosphoinositide-dependent protein kinase 1 OS=Caenorhabditis elegans GN=pdk-1 PE=1 SV=1 1039 1159 3.0E-11
sp|Q3UYH7|ARBK2_MOUSE Beta-adrenergic receptor kinase 2 OS=Mus musculus GN=Adrbk2 PE=1 SV=2 1046 1159 4.0E-11
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 1038 1133 8.0E-11
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 733 877 2.0E-10
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 1039 1153 2.0E-10
sp|Q15835|RK_HUMAN Rhodopsin kinase OS=Homo sapiens GN=GRK1 PE=1 SV=1 1035 1162 2.0E-10
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 1046 1159 3.0E-10
sp|Q09898|SID2_SCHPO Serine/threonine-protein kinase sid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid2 PE=1 SV=1 1046 1183 4.0E-10
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 1036 1159 5.0E-10
sp|P35626|ARBK2_HUMAN Beta-adrenergic receptor kinase 2 OS=Homo sapiens GN=ADRBK2 PE=1 SV=2 1046 1159 5.0E-10
sp|P32866|GPRK2_DROME G protein-coupled receptor kinase 2 OS=Drosophila melanogaster GN=Gprk2 PE=1 SV=3 1046 1173 5.0E-10
sp|P32865|GPRK1_DROME G protein-coupled receptor kinase 1 OS=Drosophila melanogaster GN=Gprk1 PE=2 SV=2 1046 1159 6.0E-10
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 1041 1133 6.0E-10
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 1038 1133 6.0E-10
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 718 873 1.0E-09
sp|Q09639|GRK2_CAEEL G protein-coupled receptor kinase 2 OS=Caenorhabditis elegans GN=grk-2 PE=3 SV=2 1046 1162 1.0E-09
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 1038 1133 1.0E-09
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 561 876 2.0E-09
sp|P26818|ARBK2_BOVIN Beta-adrenergic receptor kinase 2 OS=Bos taurus GN=ADRBK2 PE=2 SV=1 1046 1159 2.0E-09
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 561 876 3.0E-09
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 1037 1213 3.0E-09
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 1036 1158 4.0E-09
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 1041 1133 5.0E-09
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 1043 1146 8.0E-09
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 561 876 1.0E-08
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 1000 1156 1.0E-08
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 1040 1105 2.0E-08
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 1043 1159 3.0E-08
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 473 876 4.0E-08
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 1000 1137 4.0E-08
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 1000 1137 4.0E-08
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 561 876 5.0E-08
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 561 876 8.0E-08
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 1036 1158 8.0E-08
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 1036 1158 8.0E-08
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 519 876 9.0E-08
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 729 876 1.0E-07
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 729 876 1.0E-07
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 1048 1155 1.0E-07
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 1026 1162 1.0E-07
sp|Q64682|ARBK1_MESAU Beta-adrenergic receptor kinase 1 OS=Mesocricetus auratus GN=ADRBK1 PE=2 SV=1 1046 1195 2.0E-07
sp|P25098|ARBK1_HUMAN Beta-adrenergic receptor kinase 1 OS=Homo sapiens GN=ADRBK1 PE=1 SV=2 1046 1195 2.0E-07
sp|P26817|ARBK1_RAT Beta-adrenergic receptor kinase 1 OS=Rattus norvegicus GN=Adrbk1 PE=1 SV=1 1046 1195 2.0E-07
sp|Q99MK8|ARBK1_MOUSE Beta-adrenergic receptor kinase 1 OS=Mus musculus GN=Adrbk1 PE=1 SV=2 1046 1195 3.0E-07
sp|P21146|ARBK1_BOVIN Beta-adrenergic receptor kinase 1 OS=Bos taurus GN=ADRBK1 PE=1 SV=1 1046 1195 3.0E-07
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 1045 1200 3.0E-07
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 1045 1200 3.0E-07
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 1048 1137 4.0E-07
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 1045 1200 4.0E-07
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 1048 1137 5.0E-07
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 1048 1137 5.0E-07
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 804 877 6.0E-07
sp|O97627|ARBK1_DIDVI Beta-adrenergic receptor kinase 1 OS=Didelphis virginiana GN=ADRBK1 PE=1 SV=1 1046 1195 6.0E-07
sp|P28327|RK_BOVIN Rhodopsin kinase OS=Bos taurus GN=GRK1 PE=1 SV=1 1039 1162 7.0E-07
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 1433 1635 8.0E-07
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 1036 1135 9.0E-07
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 1046 1137 1.0E-06
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 1048 1137 2.0E-06
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 1043 1248 2.0E-06
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 729 876 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000160 phosphorelay signal transduction system Yes
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0007165 signal transduction No
GO:0032555 purine ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0035556 intracellular signal transduction No
GO:0043412 macromolecule modification No
GO:0016310 phosphorylation No
GO:0071704 organic substance metabolic process No
GO:0065007 biological regulation No
GO:0044238 primary metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0050789 regulation of biological process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0036211 protein modification process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0019538 protein metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5269 0.5885 0.1518 0.1983 0.0867 0.0035 0.086 0.1026 0.05 0.0114

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4114
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5025
Ophiocordyceps australis map64 (Brazil) OphauB2|2410
Ophiocordyceps camponoti-floridani Ophcf2|00144
Ophiocordyceps camponoti-rufipedis Ophun1|3536
Ophiocordyceps kimflemingae Ophio5|3793 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8330

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3793
MAENSLLLAPPAVASLRAQQAGTMERSLSQDIRDEREELREAAEQTLNVIVDLNLDGTIRWVSPSWTDVVGTPSD
TVSGTPISDLIVSKNKTVFLDVVESMKRDDSRSHRVSFSVQLGLLSKLRPVPGPGEFVAPPSDSEPQTADLEAQG
IVVYDSVSGGESHTMWMIRPWSGPHEIKIDLPDVIVDSLGSGAEVLASYLTQLAESGGDDAEERELPPSVLCRIC
ERQIHPWWFEKHTDLCLQEHRAEMDVQMAQESLTEHRHAIVRVLDALEARKSRSMTGEQSAGPMAEYKGMPIGPP
PSTQTSPATSLARSRDRAGGFGHARARSFAVRRPQARIVELVMDLCDTAIEISSPAIKESSSQSDDGDFRAQSPQ
SESRISQVLQWQSPSTNTLEQEQGLALLCADTEKVARAKVEAVFRHRRIIEYAERIRVELAVLVQDCIARAMRKA
ARLAAGRLSDSTEDEGDAGMDEVADHGLGADAPTDSAGEALRDEEPRGRSEQGLVRQSLDSPSALAAALRQMDIS
AASSRSRSQPASFVASTRSSSPKECPTPRSHAEGGLTGQLQPRDARRSSSLVLEADPTEAEGSMRSSSAASRNAL
RTESPISEFGDLRRAASARHHHRRSLVIPGNLSPRRQESPSRAAQPSSPFRIKPRVPPVPQEGAASPEASPMFPC
SEFSSPVSHPSRHHRRQSSAAISDLVMRAPSSPRLNASQAHPQPRPAQPSIKDFEIIKPISKGAFGSVYLSKKKS
TGEYFAIKVLKKADMVAKNQVGNVKAERAIMMWQGQSEFVAKLYWTFSSKEYLYLVMEYLNGGDCASLIKVLGGL
PEDWVKKYLGEVVLGVEHLHERDIIHRDLKPDNLLIDQKGHLKLTDFGLSRMGLVGRQKRALNSEAADSTPDLLK
QGPFARSTSMASSRSTSLDLHGHAQSPSTTPQTTPDAGSAVQPSFFTLAPLSHEPRRISSSHRSDSGGSEAMAHM
LSSFTLNDAEHPPQPSSAKLLAEDEAAAYASPELTARASVDSHTRSSLPQSNMMPPRMALFDPQDTNRRFVGTPD
YLAPETIKGDKQDETSDWWSVGCIMFEFLYGTPPFHAGEAEQVFENILARKIQWPDDSMCEPVSEEAKDLINKLL
CMNPKQRLGANKDEKFASGGEEIRSHLWFEGINWDTLVEDEAQFVPHPENPEDTEYFDARGAVLQSFAEEMEDQM
SPHSSTAGSDYPDRPHDALSRVRSQVNSMNRKLIPLHIPPHVRDLKSRRLSEPVATDDFGSFTFKNLPVLEKANK
DVIQKLRADALAAQSKQPSGSPGGGAVNVTTSPAPSLDASPVLSNHLHRTISGAKAGNRPQSPSGFSHSNSSPSR
ASQPSSPLLVSFIAGQGAEGRRKASNSSSLSHQSTSLQPPTSFEIPKVPPSLQKAATSAAASPVKGRGTTPAPLA
LSPQKIMATPRQGSASSTSRSRSLTLGSQEASPVTSEILQYHRNRRSQVFDMSPSSSDNEGDKHNALLRVQRRRQ
SSRRLSQITFDSGPAFRPLDVLICEDHPVSRMVMEKLLEKLRCRTISVANGSEAVRYSMSEIQFDVVFLEYKLPQ
INGADVARMIRETKNANSHTPIVAITAYLKELQAPHYFDSLIEKPISSSKLIEVLRSLCQWQPNSPQRAASGPQP
HPVPAALRKATAARVDDSPMSSVSAFAGRQGSALGSSREDSITSSLFGDSESVTTDDMAVVTTSRKETGEWDEGG
LGIAGADGATVLEGPLRGFPPLTSHHSAPSQMEHLLRPQDKKGKREAAEKKVAEKRAAEKKATEGTESADDEDEE
GDATRDMQPGRGSNPMTGKSALPSSKLGIEMMRADSHESVALCSDSTSEAVTQVVTTPSQEIGPPTLAGDAALAQ
EGGRAEADGPAEQEDTSGELARSVDATPRPTLPNRRGSEDEVTPRPAGR
Coding >Ophio5|3793
ATGGCTGAGAATTCGCTTCTATTGGCGCCTCCGGCTGTTGCCTCGCTCAGGGCACAGCAGGCAGGTACCATGGAG
AGGTCGCTGAGCCAGGACATTCGCGACGAGCGAGAGGAGCTTCGTGAGGCAGCAGAACAGACGCTAAATGTCATA
GTTGACCTCAACTTGGACGGCACCATCCGATGGGTCAGCCCGTCCTGGACTGATGTGGTTGGCACTCCCTCCGAT
ACCGTCAGTGGCACCCCCATATCCGACTTGATTGTTAGCAAGAATAAGACGGTCTTTTTAGACGTCGTCGAATCT
ATGAAGCGAGATGATTCTAGGAGTCACCGAGTCAGCTTCTCCGTCCAACTTGGCCTGCTCTCCAAATTGCGACCT
GTCCCTGGCCCCGGCGAATTTGTGGCGCCCCCCTCTGACTCCGAGCCTCAAACTGCAGACCTCGAGGCCCAGGGC
ATTGTCGTCTACGACAGTGTCTCCGGCGGAGAGAGCCATACCATGTGGATGATCCGGCCCTGGTCTGGCCCACAC
GAGATCAAGATTGACCTGCCCGACGTCATCGTCGATTCCCTTGGCTCCGGCGCCGAGGTCCTGGCCAGCTACCTC
ACCCAGCTGGCCGAGTCCGGGGGCGACGATGCGGAAGAGCGAGAGCTACCTCCCTCGGTGCTATGCCGTATCTGC
GAGCGCCAAATTCACCCTTGGTGGTTCGAAAAACACACCGACCTCTGCCTTCAAGAGCACCGCGCTGAGATGGAT
GTGCAAATGGCCCAAGAGAGCTTGACGGAGCATCGTCATGCCATCGTCCGAGTTCTCGACGCCCTGGAGGCGCGT
AAGAGTCGCTCCATGACGGGGGAGCAGTCGGCGGGCCCCATGGCGGAATACAAGGGCATGCCCATTGGCCCGCCT
CCTTCGACGCAAACTTCGCCGGCCACCTCTCTGGCCCGTTCACGCGATCGAGCTGGCGGTTTCGGTCACGCCAGG
GCCCGCTCCTTTGCCGTTCGGCGACCACAGGCCCGCATCGTCGAGCTGGTCATGGATCTCTGCGATACGGCCATC
GAGATCAGCAGCCCGGCCATCAAGGAGAGCTCCTCGCAGTCGGACGATGGCGACTTCCGCGCGCAATCGCCCCAG
TCGGAGTCGAGGATATCCCAGGTTCTGCAGTGGCAGTCGCCCAGCACAAACACCCTGGAGCAGGAGCAGGGCCTG
GCCCTTCTTTGCGCCGATACAGAAAAGGTCGCCCGGGCCAAAGTCGAAGCCGTCTTTCGCCATCGGAGGATCATT
GAGTATGCGGAGCGAATTCGCGTCGAGCTTGCCGTCTTGGTACAGGACTGCATCGCGAGGGCGATGCGAAAAGCC
GCTCGGCTCGCGGCTGGCCGACTGAGCGATTCGACTGAGGATGAAGGTGATGCTGGCATGGACGAAGTTGCGGAT
CACGGCCTCGGAGCCGACGCCCCAACGGACTCGGCCGGGGAGGCGCTGCGGGACGAGGAGCCGCGAGGTCGGTCT
GAGCAGGGCCTCGTCAGGCAGTCGCTCGACAGCCCTTCTGCCCTGGCCGCGGCTCTGCGACAGATGGACATATCG
GCCGCATCCAGCCGATCCCGATCGCAGCCGGCCTCGTTCGTCGCGTCGACGCGTTCCAGCAGCCCCAAGGAGTGC
CCGACACCGCGCTCCCACGCCGAGGGGGGGTTGACGGGCCAGCTCCAGCCCCGAGACGCCCGTAGGTCGTCGTCG
CTCGTCTTGGAGGCGGACCCTACCGAAGCCGAGGGGAGTATGCGATCATCGTCGGCCGCGTCGCGGAACGCGCTG
AGGACGGAATCGCCCATTTCGGAGTTTGGGGACCTCCGACGCGCTGCAAGCGCCAGGCATCATCACCGTCGGAGC
CTCGTCATTCCGGGGAATTTATCGCCACGGCGCCAAGAGTCGCCGTCTCGCGCCGCGCAGCCGTCGTCGCCTTTC
CGGATCAAGCCCAGAGTGCCGCCAGTCCCCCAAGAGGGTGCGGCGTCTCCCGAGGCGTCGCCCATGTTCCCATGC
AGCGAATTCAGCTCGCCCGTGTCTCACCCTTCCCGACACCACCGGAGACAATCGTCGGCTGCCATCTCGGATCTT
GTCATGAGGGCACCATCGTCCCCGCGCCTCAACGCCAGTCAGGCGCACCCCCAACCCCGACCTGCACAGCCATCG
ATCAAGGACTTCGAAATCATCAAGCCCATCAGCAAGGGTGCATTTGGAAGTGTCTATCTTTCTAAGAAGAAATCC
ACGGGCGAGTACTTTGCCATAAAGGTCCTCAAAAAGGCAGACATGGTGGCCAAGAACCAGGTCGGCAACGTCAAG
GCGGAGCGTGCCATCATGATGTGGCAGGGACAAAGCGAGTTCGTCGCCAAGCTCTACTGGACCTTTTCAAGCAAG
GAGTATCTCTACCTCGTCATGGAGTATCTCAACGGAGGCGACTGTGCCTCGCTCATCAAAGTCCTGGGAGGCCTC
CCCGAGGACTGGGTCAAGAAGTATCTGGGCGAGGTCGTCCTCGGCGTCGAGCATCTCCACGAAAGAGACATCATC
CACCGCGACCTCAAGCCGGACAACCTGCTGATTGATCAGAAAGGCCACCTCAAGCTGACCGACTTTGGCCTCTCG
CGCATGGGCTTGGTGGGCCGGCAGAAGCGGGCGCTCAACAGCGAGGCGGCGGATTCGACGCCTGATTTGCTGAAG
CAAGGGCCCTTTGCTCGCTCCACGTCAATGGCCTCGTCTCGCTCCACGTCGCTTGACCTGCACGGGCACGCGCAG
TCGCCCAGCACAACGCCGCAGACTACACCGGACGCGGGCAGTGCCGTACAGCCGTCCTTCTTCACCCTGGCTCCT
CTTTCTCACGAGCCGCGACGGATATCCAGCAGCCACCGGAGCGACAGCGGTGGCAGCGAGGCAATGGCGCACATG
CTCTCCTCCTTCACCCTCAATGACGCGGAACACCCGCCTCAGCCGTCCAGTGCCAAGCTATTGGCCGAAGACGAG
GCCGCGGCTTATGCATCGCCAGAGCTGACAGCCAGAGCCAGTGTCGACAGTCACACGCGGAGCTCGCTGCCCCAG
TCCAACATGATGCCCCCTCGCATGGCGCTCTTTGATCCCCAGGACACGAATCGCCGCTTCGTTGGCACGCCTGAC
TACTTAGCCCCGGAGACCATCAAGGGTGACAAGCAGGACGAGACGAGCGATTGGTGGTCCGTGGGCTGCATCATG
TTCGAGTTCCTCTACGGGACGCCCCCCTTTCACGCAGGCGAGGCGGAACAGGTGTTTGAAAACATACTGGCTCGC
AAGATACAGTGGCCCGACGACAGCATGTGCGAGCCTGTCTCGGAGGAAGCCAAGGACCTTATCAATAAACTGCTC
TGCATGAACCCGAAACAGAGACTGGGCGCCAACAAGGACGAAAAGTTTGCCTCGGGCGGCGAAGAGATCCGGAGC
CACCTGTGGTTCGAGGGGATCAACTGGGACACGCTGGTCGAGGACGAAGCGCAGTTCGTGCCGCACCCTGAGAAC
CCGGAGGATACGGAATACTTCGACGCCAGAGGCGCCGTCCTTCAGTCCTTTGCCGAGGAAATGGAGGACCAAATG
TCACCGCATTCCTCGACGGCCGGCTCCGATTACCCAGACAGACCGCACGACGCTCTGTCGCGAGTCCGATCTCAG
GTCAACTCGATGAATCGCAAGCTGATACCGCTCCATATCCCACCTCATGTGCGGGATCTGAAGTCGCGGCGACTC
AGCGAGCCCGTGGCTACTGACGACTTCGGATCTTTCACCTTTAAGAACTTGCCGGTGCTGGAAAAGGCCAACAAG
GACGTCATCCAGAAGCTGCGAGCCGACGCACTGGCCGCGCAGAGCAAGCAGCCTTCGGGCAGTCCCGGCGGCGGG
GCGGTCAACGTGACGACGTCTCCCGCCCCGTCTCTCGATGCCAGTCCCGTCCTGTCCAACCACCTGCACAGGACC
ATCTCAGGGGCCAAGGCCGGTAACCGACCGCAGTCGCCGTCTGGCTTCAGTCACTCCAACTCGTCGCCGAGCCGG
GCTTCGCAGCCGTCGTCTCCACTGCTCGTCTCCTTCATTGCCGGACAGGGAGCCGAGGGACGGAGAAAGGCATCT
AACTCATCCAGTCTGTCGCATCAATCCACCTCGTTGCAGCCTCCCACCTCGTTCGAGATACCCAAAGTGCCGCCG
AGTCTGCAGAAGGCGGCGACGTCGGCGGCGGCATCGCCCGTCAAGGGCCGAGGCACGACCCCGGCGCCGCTGGCG
CTCTCGCCCCAGAAGATCATGGCGACGCCGCGACAAGGTAGCGCCTCGTCCACCAGTCGCTCCAGGTCCCTAACG
CTGGGCTCACAAGAAGCGAGCCCCGTGACGTCGGAGATCTTGCAGTATCACCGCAATCGTCGGAGTCAAGTGTTC
GACATGTCCCCTTCGTCGTCCGACAACGAAGGGGACAAACACAACGCGTTACTGCGGGTTCAGCGGCGCAGGCAA
AGCTCGCGGCGGCTCTCCCAGATCACCTTCGACAGCGGGCCGGCGTTCCGGCCGCTTGATGTCCTCATCTGCGAG
GATCATCCGGTGTCGAGGATGGTGATGGAGAAGCTGCTGGAAAAGCTTCGCTGCCGGACCATCTCGGTCGCAAAC
GGCTCCGAGGCCGTCAGATACTCGATGAGCGAGATACAATTCGACGTCGTCTTCCTCGAGTACAAATTGCCACAG
ATCAACGGGGCTGACGTGGCGCGCATGATCCGGGAGACGAAGAACGCCAACTCGCATACGCCCATCGTGGCCATC
ACGGCCTACCTCAAGGAGCTCCAGGCCCCCCATTACTTTGACTCGCTCATCGAGAAGCCCATCAGCTCGTCCAAG
CTCATCGAGGTGCTTCGAAGCCTCTGCCAGTGGCAGCCGAACTCGCCCCAGCGCGCGGCGTCCGGTCCGCAGCCT
CACCCAGTACCCGCCGCTTTACGCAAGGCCACCGCCGCTCGGGTGGACGACAGCCCGATGTCGAGCGTATCGGCC
TTTGCGGGCCGGCAGGGCTCAGCGTTGGGCTCGAGCCGCGAGGACTCGATTACGTCGAGCCTGTTCGGCGATTCG
GAATCGGTGACGACAGATGACATGGCCGTGGTGACGACTAGCCGCAAGGAAACGGGCGAGTGGGACGAGGGTGGG
CTGGGCATTGCCGGCGCGGACGGGGCGACGGTGCTCGAGGGGCCCCTCCGGGGATTCCCCCCCCTCACGTCGCAC
CACTCGGCGCCGAGCCAGATGGAGCACCTACTACGGCCGCAAGATAAGAAGGGTAAGCGTGAGGCGGCGGAGAAG
AAGGTAGCGGAGAAGAGGGCGGCGGAGAAGAAGGCGACGGAGGGGACCGAATCGGCCGACGACGAAGACGAAGAG
GGCGACGCGACGCGGGACATGCAGCCCGGTCGAGGCAGCAACCCCATGACGGGCAAGTCGGCGCTGCCGAGCTCG
AAGCTGGGCATCGAAATGATGCGAGCGGACAGCCACGAGAGCGTGGCTCTGTGCTCAGACAGCACATCAGAGGCG
GTCACCCAAGTCGTCACGACACCCTCTCAGGAGATTGGCCCGCCCACGCTAGCTGGCGACGCAGCACTCGCACAG
GAAGGTGGCAGGGCAGAAGCCGACGGGCCGGCGGAGCAGGAAGACACTAGCGGGGAGCTCGCGAGAAGCGTGGAT
GCGACGCCGCGGCCGACGCTGCCAAACCGCCGGGGCTCGGAGGACGAAGTGACGCCTCGACCTGCCGGCAGA
Transcript >Ophio5|3793
ATGGCTGAGAATTCGCTTCTATTGGCGCCTCCGGCTGTTGCCTCGCTCAGGGCACAGCAGGCAGGTACCATGGAG
AGGTCGCTGAGCCAGGACATTCGCGACGAGCGAGAGGAGCTTCGTGAGGCAGCAGAACAGACGCTAAATGTCATA
GTTGACCTCAACTTGGACGGCACCATCCGATGGGTCAGCCCGTCCTGGACTGATGTGGTTGGCACTCCCTCCGAT
ACCGTCAGTGGCACCCCCATATCCGACTTGATTGTTAGCAAGAATAAGACGGTCTTTTTAGACGTCGTCGAATCT
ATGAAGCGAGATGATTCTAGGAGTCACCGAGTCAGCTTCTCCGTCCAACTTGGCCTGCTCTCCAAATTGCGACCT
GTCCCTGGCCCCGGCGAATTTGTGGCGCCCCCCTCTGACTCCGAGCCTCAAACTGCAGACCTCGAGGCCCAGGGC
ATTGTCGTCTACGACAGTGTCTCCGGCGGAGAGAGCCATACCATGTGGATGATCCGGCCCTGGTCTGGCCCACAC
GAGATCAAGATTGACCTGCCCGACGTCATCGTCGATTCCCTTGGCTCCGGCGCCGAGGTCCTGGCCAGCTACCTC
ACCCAGCTGGCCGAGTCCGGGGGCGACGATGCGGAAGAGCGAGAGCTACCTCCCTCGGTGCTATGCCGTATCTGC
GAGCGCCAAATTCACCCTTGGTGGTTCGAAAAACACACCGACCTCTGCCTTCAAGAGCACCGCGCTGAGATGGAT
GTGCAAATGGCCCAAGAGAGCTTGACGGAGCATCGTCATGCCATCGTCCGAGTTCTCGACGCCCTGGAGGCGCGT
AAGAGTCGCTCCATGACGGGGGAGCAGTCGGCGGGCCCCATGGCGGAATACAAGGGCATGCCCATTGGCCCGCCT
CCTTCGACGCAAACTTCGCCGGCCACCTCTCTGGCCCGTTCACGCGATCGAGCTGGCGGTTTCGGTCACGCCAGG
GCCCGCTCCTTTGCCGTTCGGCGACCACAGGCCCGCATCGTCGAGCTGGTCATGGATCTCTGCGATACGGCCATC
GAGATCAGCAGCCCGGCCATCAAGGAGAGCTCCTCGCAGTCGGACGATGGCGACTTCCGCGCGCAATCGCCCCAG
TCGGAGTCGAGGATATCCCAGGTTCTGCAGTGGCAGTCGCCCAGCACAAACACCCTGGAGCAGGAGCAGGGCCTG
GCCCTTCTTTGCGCCGATACAGAAAAGGTCGCCCGGGCCAAAGTCGAAGCCGTCTTTCGCCATCGGAGGATCATT
GAGTATGCGGAGCGAATTCGCGTCGAGCTTGCCGTCTTGGTACAGGACTGCATCGCGAGGGCGATGCGAAAAGCC
GCTCGGCTCGCGGCTGGCCGACTGAGCGATTCGACTGAGGATGAAGGTGATGCTGGCATGGACGAAGTTGCGGAT
CACGGCCTCGGAGCCGACGCCCCAACGGACTCGGCCGGGGAGGCGCTGCGGGACGAGGAGCCGCGAGGTCGGTCT
GAGCAGGGCCTCGTCAGGCAGTCGCTCGACAGCCCTTCTGCCCTGGCCGCGGCTCTGCGACAGATGGACATATCG
GCCGCATCCAGCCGATCCCGATCGCAGCCGGCCTCGTTCGTCGCGTCGACGCGTTCCAGCAGCCCCAAGGAGTGC
CCGACACCGCGCTCCCACGCCGAGGGGGGGTTGACGGGCCAGCTCCAGCCCCGAGACGCCCGTAGGTCGTCGTCG
CTCGTCTTGGAGGCGGACCCTACCGAAGCCGAGGGGAGTATGCGATCATCGTCGGCCGCGTCGCGGAACGCGCTG
AGGACGGAATCGCCCATTTCGGAGTTTGGGGACCTCCGACGCGCTGCAAGCGCCAGGCATCATCACCGTCGGAGC
CTCGTCATTCCGGGGAATTTATCGCCACGGCGCCAAGAGTCGCCGTCTCGCGCCGCGCAGCCGTCGTCGCCTTTC
CGGATCAAGCCCAGAGTGCCGCCAGTCCCCCAAGAGGGTGCGGCGTCTCCCGAGGCGTCGCCCATGTTCCCATGC
AGCGAATTCAGCTCGCCCGTGTCTCACCCTTCCCGACACCACCGGAGACAATCGTCGGCTGCCATCTCGGATCTT
GTCATGAGGGCACCATCGTCCCCGCGCCTCAACGCCAGTCAGGCGCACCCCCAACCCCGACCTGCACAGCCATCG
ATCAAGGACTTCGAAATCATCAAGCCCATCAGCAAGGGTGCATTTGGAAGTGTCTATCTTTCTAAGAAGAAATCC
ACGGGCGAGTACTTTGCCATAAAGGTCCTCAAAAAGGCAGACATGGTGGCCAAGAACCAGGTCGGCAACGTCAAG
GCGGAGCGTGCCATCATGATGTGGCAGGGACAAAGCGAGTTCGTCGCCAAGCTCTACTGGACCTTTTCAAGCAAG
GAGTATCTCTACCTCGTCATGGAGTATCTCAACGGAGGCGACTGTGCCTCGCTCATCAAAGTCCTGGGAGGCCTC
CCCGAGGACTGGGTCAAGAAGTATCTGGGCGAGGTCGTCCTCGGCGTCGAGCATCTCCACGAAAGAGACATCATC
CACCGCGACCTCAAGCCGGACAACCTGCTGATTGATCAGAAAGGCCACCTCAAGCTGACCGACTTTGGCCTCTCG
CGCATGGGCTTGGTGGGCCGGCAGAAGCGGGCGCTCAACAGCGAGGCGGCGGATTCGACGCCTGATTTGCTGAAG
CAAGGGCCCTTTGCTCGCTCCACGTCAATGGCCTCGTCTCGCTCCACGTCGCTTGACCTGCACGGGCACGCGCAG
TCGCCCAGCACAACGCCGCAGACTACACCGGACGCGGGCAGTGCCGTACAGCCGTCCTTCTTCACCCTGGCTCCT
CTTTCTCACGAGCCGCGACGGATATCCAGCAGCCACCGGAGCGACAGCGGTGGCAGCGAGGCAATGGCGCACATG
CTCTCCTCCTTCACCCTCAATGACGCGGAACACCCGCCTCAGCCGTCCAGTGCCAAGCTATTGGCCGAAGACGAG
GCCGCGGCTTATGCATCGCCAGAGCTGACAGCCAGAGCCAGTGTCGACAGTCACACGCGGAGCTCGCTGCCCCAG
TCCAACATGATGCCCCCTCGCATGGCGCTCTTTGATCCCCAGGACACGAATCGCCGCTTCGTTGGCACGCCTGAC
TACTTAGCCCCGGAGACCATCAAGGGTGACAAGCAGGACGAGACGAGCGATTGGTGGTCCGTGGGCTGCATCATG
TTCGAGTTCCTCTACGGGACGCCCCCCTTTCACGCAGGCGAGGCGGAACAGGTGTTTGAAAACATACTGGCTCGC
AAGATACAGTGGCCCGACGACAGCATGTGCGAGCCTGTCTCGGAGGAAGCCAAGGACCTTATCAATAAACTGCTC
TGCATGAACCCGAAACAGAGACTGGGCGCCAACAAGGACGAAAAGTTTGCCTCGGGCGGCGAAGAGATCCGGAGC
CACCTGTGGTTCGAGGGGATCAACTGGGACACGCTGGTCGAGGACGAAGCGCAGTTCGTGCCGCACCCTGAGAAC
CCGGAGGATACGGAATACTTCGACGCCAGAGGCGCCGTCCTTCAGTCCTTTGCCGAGGAAATGGAGGACCAAATG
TCACCGCATTCCTCGACGGCCGGCTCCGATTACCCAGACAGACCGCACGACGCTCTGTCGCGAGTCCGATCTCAG
GTCAACTCGATGAATCGCAAGCTGATACCGCTCCATATCCCACCTCATGTGCGGGATCTGAAGTCGCGGCGACTC
AGCGAGCCCGTGGCTACTGACGACTTCGGATCTTTCACCTTTAAGAACTTGCCGGTGCTGGAAAAGGCCAACAAG
GACGTCATCCAGAAGCTGCGAGCCGACGCACTGGCCGCGCAGAGCAAGCAGCCTTCGGGCAGTCCCGGCGGCGGG
GCGGTCAACGTGACGACGTCTCCCGCCCCGTCTCTCGATGCCAGTCCCGTCCTGTCCAACCACCTGCACAGGACC
ATCTCAGGGGCCAAGGCCGGTAACCGACCGCAGTCGCCGTCTGGCTTCAGTCACTCCAACTCGTCGCCGAGCCGG
GCTTCGCAGCCGTCGTCTCCACTGCTCGTCTCCTTCATTGCCGGACAGGGAGCCGAGGGACGGAGAAAGGCATCT
AACTCATCCAGTCTGTCGCATCAATCCACCTCGTTGCAGCCTCCCACCTCGTTCGAGATACCCAAAGTGCCGCCG
AGTCTGCAGAAGGCGGCGACGTCGGCGGCGGCATCGCCCGTCAAGGGCCGAGGCACGACCCCGGCGCCGCTGGCG
CTCTCGCCCCAGAAGATCATGGCGACGCCGCGACAAGGTAGCGCCTCGTCCACCAGTCGCTCCAGGTCCCTAACG
CTGGGCTCACAAGAAGCGAGCCCCGTGACGTCGGAGATCTTGCAGTATCACCGCAATCGTCGGAGTCAAGTGTTC
GACATGTCCCCTTCGTCGTCCGACAACGAAGGGGACAAACACAACGCGTTACTGCGGGTTCAGCGGCGCAGGCAA
AGCTCGCGGCGGCTCTCCCAGATCACCTTCGACAGCGGGCCGGCGTTCCGGCCGCTTGATGTCCTCATCTGCGAG
GATCATCCGGTGTCGAGGATGGTGATGGAGAAGCTGCTGGAAAAGCTTCGCTGCCGGACCATCTCGGTCGCAAAC
GGCTCCGAGGCCGTCAGATACTCGATGAGCGAGATACAATTCGACGTCGTCTTCCTCGAGTACAAATTGCCACAG
ATCAACGGGGCTGACGTGGCGCGCATGATCCGGGAGACGAAGAACGCCAACTCGCATACGCCCATCGTGGCCATC
ACGGCCTACCTCAAGGAGCTCCAGGCCCCCCATTACTTTGACTCGCTCATCGAGAAGCCCATCAGCTCGTCCAAG
CTCATCGAGGTGCTTCGAAGCCTCTGCCAGTGGCAGCCGAACTCGCCCCAGCGCGCGGCGTCCGGTCCGCAGCCT
CACCCAGTACCCGCCGCTTTACGCAAGGCCACCGCCGCTCGGGTGGACGACAGCCCGATGTCGAGCGTATCGGCC
TTTGCGGGCCGGCAGGGCTCAGCGTTGGGCTCGAGCCGCGAGGACTCGATTACGTCGAGCCTGTTCGGCGATTCG
GAATCGGTGACGACAGATGACATGGCCGTGGTGACGACTAGCCGCAAGGAAACGGGCGAGTGGGACGAGGGTGGG
CTGGGCATTGCCGGCGCGGACGGGGCGACGGTGCTCGAGGGGCCCCTCCGGGGATTCCCCCCCCTCACGTCGCAC
CACTCGGCGCCGAGCCAGATGGAGCACCTACTACGGCCGCAAGATAAGAAGGGTAAGCGTGAGGCGGCGGAGAAG
AAGGTAGCGGAGAAGAGGGCGGCGGAGAAGAAGGCGACGGAGGGGACCGAATCGGCCGACGACGAAGACGAAGAG
GGCGACGCGACGCGGGACATGCAGCCCGGTCGAGGCAGCAACCCCATGACGGGCAAGTCGGCGCTGCCGAGCTCG
AAGCTGGGCATCGAAATGATGCGAGCGGACAGCCACGAGAGCGTGGCTCTGTGCTCAGACAGCACATCAGAGGCG
GTCACCCAAGTCGTCACGACACCCTCTCAGGAGATTGGCCCGCCCACGCTAGCTGGCGACGCAGCACTCGCACAG
GAAGGTGGCAGGGCAGAAGCCGACGGGCCGGCGGAGCAGGAAGACACTAGCGGGGAGCTCGCGAGAAGCGTGGAT
GCGACGCCGCGGCCGACGCTGCCAAACCGCCGGGGCTCGGAGGACGAAGTGACGCCTCGACCTGCCGGCAGATAG
Gene >Ophio5|3793
ATGGCTGAGAATTCGCTTCTATTGGCGCCTCCGGCTGTTGCCTCGCTCAGGGCACAGCAGGCAGGTACCATGGAG
AGGTCGCTGAGCCAGGACATTCGCGACGAGCGAGAGGAGCTTCGTGAGGCAGCAGAACAGACGCTAAATGTCATA
GTTGACCTCAACTTGGACGGCACCATCCGATGGGTCAGCCCGTCCTGGACTGATGTGGTTGGCACTCCCTCCGAT
ACCGTCAGTGGCACCCCCATATCCGACTTGATTGTTAGCAAGAATAAGACGGTCTTTTTAGACGTCGTCGAATCT
ATGAAGCGAGATGATTCTAGGAGTCACCGAGTCAGCTTCTCCGTCCAACTTGGCCTGCTCTCCAAATTGCGACCT
GTCCCTGGCCCCGGCGAATTTGTGGCGCCCCCCTCTGACTCCGAGCCTCAAACTGCAGACCTCGAGGCCCAGGGC
ATTGTCGTCTACGACAGTGTCTCCGGCGGAGAGAGCCATGTTGGTTTGACCGTTCCCTCCCCCCTCTAAGCAAGC
TGCTAACGCTTCGCCGTCATTCTAGACCATGTGGATGATCCGGCCCTGGTCTGGCCCACACGAGATCAAGATTGA
CCTGCCCGACGTCATCGTCGATTCCCTTGGCTCCGGCGCCGAGGTCCTGGCCAGCTACCTCACCCAGCTGGCCGA
GTCCGGGGGCGACGATGCGGAAGAGCGAGAGCTACCTCCCTCGGTGCTATGCCGTATCTGCGAGCGCCAAATTCA
CCCTTGGTGGTTCGAAAAACACACCGACCTCTGCCTTCAAGAGCACCGCGCTGAGATGGATGTGCAAATGGCCCA
AGAGAGCTTGACGGAGCATCGTCATGCCATCGTCCGAGTTCTCGACGCCCTGGAGGCGCGTAAGAGTCGCTCCAT
GACGGGGGAGCAGTCGGCGGGCCCCATGGCGGAATACAAGGGCATGCCCATTGGCCCGCCTCCTTCGACGCAAAC
TTCGCCGGCCACCTCTCTGGCCCGTTCACGCGATCGAGCTGGCGGTTTCGGTCACGCCAGGGCCCGCTCCTTTGC
CGTTCGGCGACCACAGGCCCGCATCGTCGAGCTGGTCATGGATCTCTGCGATACGGCCATCGAGATCAGCAGCCC
GGCCATCAAGGAGAGCTCCTCGCAGTCGGACGATGGCGACTTCCGCGCGCAATCGCCCCAGTCGGAGTCGAGGAT
ATCCCAGGTTCTGCAGTGGCAGTCGCCCAGCACAAACACCCTGGAGCAGGAGCAGGGCCTGGCCCTTCTTTGCGC
CGATACAGAAAAGGTCGCCCGGGCCAAAGTCGAAGCCGTCTTTCGCCATCGGAGGATCATTGAGTATGCGGAGCG
AATTCGCGTCGAGCTTGCCGTCTTGGTACAGGACTGCATCGCGAGGGCGATGCGAAAAGCCGCTCGGCTCGCGGC
TGGCCGACTGAGCGATTCGACTGAGGATGAAGGTGATGCTGGCATGGACGAAGTTGCGGATCACGGCCTCGGAGC
CGACGCCCCAACGGACTCGGCCGGGGAGGCGCTGCGGGACGAGGAGCCGCGAGGTCGGTCTGAGCAGGGCCTCGT
CAGGCAGTCGCTCGACAGCCCTTCTGCCCTGGCCGCGGCTCTGCGACAGATGGACATATCGGCCGCATCCAGCCG
ATCCCGATCGCAGCCGGCCTCGTTCGTCGCGTCGACGCGTTCCAGCAGCCCCAAGGAGTGCCCGACACCGCGCTC
CCACGCCGAGGGGGGGTTGACGGGCCAGCTCCAGCCCCGAGACGCCCGTAGGTCGTCGTCGCTCGTCTTGGAGGC
GGACCCTACCGAAGCCGAGGGGAGTATGCGATCATCGTCGGCCGCGTCGCGGAACGCGCTGAGGACGGAATCGCC
CATTTCGGAGTTTGGGGACCTCCGACGCGCTGCAAGCGCCAGGCATCATCACCGTCGGAGCCTCGTCATTCCGGG
GAATTTATCGCCACGGCGCCAAGAGTCGCCGTCTCGCGCCGCGCAGCCGTCGTCGCCTTTCCGGATCAAGCCCAG
AGTGCCGCCAGTCCCCCAAGAGGGTGCGGCGTCTCCCGAGGCGTCGCCCATGTTCCCATGCAGCGAATTCAGCTC
GCCCGTGTCTCACCCTTCCCGACACCACCGGAGACAATCGTCGGCTGCCATCTCGGATCTTGTCATGAGGGCACC
ATCGTCCCCGCGCCTCAACGCCAGTCAGGCGCACCCCCAACCCCGACCTGCACAGCCATCGATCAAGGACTTCGA
AATCATCAAGCCCATCAGCAAGGGTGCATTTGGAAGTGTCTATCTTTCTAAGAAGAAATCCACGGGCGAGTACTT
TGCCATAAAGGTCCTCAAAAAGGCAGACATGGTGGCCAAGAACCAGGTCGGCAACGTCAAGGCGGAGCGTGCCAT
CATGATGTGGCAGGGACAAAGCGAGTTCGTCGCCAAGCTCTACTGGACCTTTTCAAGCAAGGAGTATCTCTACCT
CGTCATGGAGTATCTCAACGGAGGCGACTGTGCCTCGCTCATCAAAGTCCTGGGAGGCCTCCCCGAGGACTGGGT
CAAGAAGTATCTGGGCGAGGTCGTCCTCGGCGTCGAGCATCTCCACGAAAGAGACATCATCCACCGCGACCTCAA
GCCGGACAACCTGCTGATTGATCAGAAAGGCCACCTCAAGCTGACCGACTTTGGCCTCTCGCGCATGGGCTTGGT
GGGCCGGCAGAAGCGGGCGCTCAACAGCGAGGCGGCGGATTCGACGCCTGATTTGCTGAAGCAAGGGCCCTTTGC
TCGCTCCACGTCAATGGCCTCGTCTCGCTCCACGTCGCTTGACCTGCACGGGCACGCGCAGTCGCCCAGCACAAC
GCCGCAGACTACACCGGACGCGGGCAGTGCCGTACAGCCGTCCTTCTTCACCCTGGCTCCTCTTTCTCACGAGCC
GCGACGGATATCCAGCAGCCACCGGAGCGACAGCGGTGGCAGCGAGGCAATGGCGCACATGCTCTCCTCCTTCAC
CCTCAATGACGCGGAACACCCGCCTCAGCCGTCCAGTGCCAAGCTATTGGCCGAAGACGAGGCCGCGGCTTATGC
ATCGCCAGAGCTGACAGCCAGAGCCAGTGTCGACAGTCACACGCGGAGCTCGCTGCCCCAGTCCAACATGATGCC
CCCTCGCATGGCGCTCTTTGATCCCCAGGACACGAATCGCCGCTTCGTTGGCACGCCTGACTACTTAGCCCCGGA
GACCATCAAGGGTGACAAGCAGGACGAGACGAGCGATTGGTGGTCCGTGGGCTGCATCATGTTCGAGTTCCTCTA
CGGGACGCCCCCCTTTCACGCAGGCGAGGCGGAACAGGTGTTTGAAAACATACTGGCTCGCAAGATACAGTGGCC
CGACGACAGCATGTGCGAGCCTGTCTCGGAGGAAGCCAAGGACCTTATCAATAAACTGCTCTGCATGAACCCGAA
ACAGAGACTGGGCGCCAACAAGGACGAAAAGTTTGCCTCGGGCGGCGAAGAGATCCGGAGCCACCTGTGGTTCGA
GGGGATCAACTGGGACACGCTGGTCGAGGACGAAGCGCAGTTCGTGCCGCACCCTGAGAACCCGGAGGATACGGA
ATACTTCGACGCCAGAGGCGCCGTCCTTCAGTCCTTTGCCGAGGAAATGGAGGACCAAATGTCACCGCATTCCTC
GACGGCCGGCTCCGATTACCCAGACAGACCGCACGACGCTCTGTCGCGAGTCCGATCTCAGGTCAACTCGATGAA
TCGCAAGCTGATACCGCTCCATATCCCACCTCATGTGCGGGATCTGAAGTCGCGGCGACTCAGCGAGCCCGTGGC
TACTGACGACTTCGGATCTTTCACCTTTAAGAACTTGCCGGTGCTGGAAAAGGCCAACAAGGACGTCATCCAGAA
GCTGCGAGCCGACGCACTGGCCGCGCAGAGCAAGCAGCCTTCGGGCAGTCCCGGCGGCGGGGCGGTCAACGTGAC
GACGTCTCCCGCCCCGTCTCTCGATGCCAGTCCCGTCCTGTCCAACCACCTGCACAGGACCATCTCAGGGGCCAA
GGCCGGTAACCGACCGCAGTCGCCGTCTGGCTTCAGTCACTCCAACTCGTCGCCGAGCCGGGCTTCGCAGCCGTC
GTCTCCACTGCTCGTCTCCTTCATTGCCGGACAGGGAGCCGAGGGACGGAGAAAGGCATCTAACTCATCCAGTCT
GTCGCATCAATCCACCTCGTTGCAGCCTCCCACCTCGTTCGAGATACCCAAAGTGCCGCCGAGTCTGCAGAAGGC
GGCGACGTCGGCGGCGGCATCGCCCGTCAAGGGCCGAGGCACGACCCCGGCGCCGCTGGCGCTCTCGCCCCAGAA
GATCATGGCGACGCCGCGACAAGGTAGCGCCTCGTCCACCAGTCGCTCCAGGTCCCTAACGCTGGGCTCACAAGA
AGCGAGCCCCGTGACGTCGGAGATCTTGCAGTATCACCGCAATCGTCGGAGTCAAGTGTTCGACATGTCCCCTTC
GTCGTCCGACAACGAAGGGGACAAACACAACGCGTTACTGCGGGTTCAGCGGCGCAGGCAAAGCTCGCGGCGGCT
CTCCCAGATCACCTTCGACAGCGGGCCGGCGTTCCGGCCGCTTGATGTCCTCATCTGCGAGGATCATCCGGTGTC
GAGGATGGTGATGGAGAAGCTGCTGGAAAAGCTTCGCTGCCGGACCATCTCGGTCGCAAACGGCTCCGAGGCCGT
CAGATACTCGATGAGCGAGATACAATTCGACGTCGTCTTCCTCGAGTACAAATTGCCACAGATCAACGGGGCTGA
CGTGGCGCGCATGATCCGGGAGACGAAGAACGCCAACTCGCATACGCCCATCGTGGCCATCACGGCCTACCTCAA
GGAGCTCCAGGCCCCCCATTACTTTGACTCGCTCATCGAGAAGCCCATCAGCTCGTCCAAGCTCATCGAGGTGCT
TCGAAGCCTCTGCCAGTGGCAGCCGAACTCGCCCCAGCGCGCGGCGTCCGGTCCGCAGCCTCACCCAGTACCCGC
CGCTTTACGCAAGGCCACCGCCGCTCGGGTGGACGACAGCCCGATGTCGAGCGTATCGGCCTTTGCGGGCCGGCA
GGGCTCAGCGTTGGGCTCGAGCCGCGAGGACTCGATTACGTCGAGCCTGTTCGGCGATTCGGAATCGGTGACGAC
AGATGACATGGCCGTGGTGACGACTAGCCGCAAGGAAACGGGCGAGTGGGACGAGGGTGGGCTGGGCATTGCCGG
CGCGGACGGGGCGACGGTGCTCGAGGGGCCCCTCCGGGGATTCCCCCCCCTCACGTCGCACCACTCGGCGCCGAG
CCAGATGGAGCACCTACTACGGCCGCAAGATAAGAAGGGTAAGCGTGAGGCGGCGGAGAAGAAGGTAGCGGAGAA
GAGGGCGGCGGAGAAGAAGGCGACGGAGGGGACCGAATCGGCCGACGACGAAGACGAAGAGGGCGACGCGACGCG
GGACATGCAGCCCGGTCGAGGCAGCAACCCCATGACGGGCAAGTCGGCGCTGCCGAGCTCGAAGCTGGGCATCGA
AATGATGCGAGCGGACAGCCACGAGAGCGTGGCTCTGTGCTCAGACAGCACATCAGAGGCGGTCACCCAAGTCGT
CACGACACCCTCTCAGGAGATTGGCCCGCCCACGCTAGCTGGCGACGCAGCACTCGCACAGGAAGGTGGCAGGGC
AGAAGCCGACGGGCCGGCGGAGCAGGAAGACACTAGCGGGGAGCTCGCGAGAAGCGTGGATGCGACGCCGCGGCC
GACGCTGCCAAACCGCCGGGGCTCGGAGGACGAAGTGACGCCTCGACCTGCCGGCAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail