Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3791
Gene name
Locationscaffold_3:5913..8069
Strand-
Gene length (bp)2156
Transcript length (bp)2001
Coding sequence length (bp)1998
Protein length (aa) 666

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 6.0E-08 127 303
PF00083 Sugar_tr Sugar (and other) transporter 2.1E-15 377 564

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 100 562 5.0E-40
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 114 579 7.0E-40
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 101 559 1.0E-39
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 114 561 6.0E-39
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 114 559 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 100 562 5.0E-40
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 114 579 7.0E-40
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 101 559 1.0E-39
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 114 561 6.0E-39
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 114 559 2.0E-38
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 114 559 2.0E-38
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 114 579 4.0E-38
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 114 559 2.0E-37
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 98 559 4.0E-37
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 98 559 6.0E-37
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 114 563 6.0E-37
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 114 562 2.0E-36
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 95 559 3.0E-36
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 100 586 5.0E-36
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 114 561 7.0E-36
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 114 563 2.0E-35
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 114 561 2.0E-35
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 116 562 2.0E-35
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 102 561 1.0E-34
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 114 559 2.0E-32
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 114 559 1.0E-31
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 114 561 4.0E-31
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 98 504 1.0E-30
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 114 504 4.0E-30
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 171 565 4.0E-29
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 333 577 3.0E-27
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 110 528 6.0E-26
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 331 562 4.0E-24
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 336 571 6.0E-20
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 120 567 5.0E-19
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 115 590 9.0E-19
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 94 356 2.0E-08
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 116 294 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 161 183 22
2 198 220 22
3 270 292 22
4 307 327 20
5 353 375 22
6 404 426 22
7 439 456 17
8 503 525 22
9 532 549 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 70.79 38.42 103.17
CcL In ants, during behavior modification 99.50 47.25 151.74
CcD In ants, recently dead 32.25 17.38 47.12

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.173746 no
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3791
MALKDDSLPETAIHQRHHRHTPVVPGQVLVPYGPPTDSDSDDYGLAVGNRDERRIFSHITRPDDCYTPEGVYWAD
LPWADRVTFVSRVDRRVTAQEFRSLGSMIKKDPLSPLSWYFRHAVVPGAGLGLEGYVLFSIGNLEPLFRQVWPQC
WDKYQVCGQNWVASVTYLEIIGIMVGQAAVGVIGDWIGRRWGLIQDALIMLIGLLMLTASWGLTLEGWVICYAWS
LFFYSLGVGGEYPITATSSLEGADTAGKLSTREDRLHRGRRVTMAFLMQGWGQFVNQVLLMALLVIFNKGSGSPP
YSNSSAQFAFRLSFAFPAVGTAWLVYYRTWKMPHASRQLADAKSRSNVTGYDVRALSYCFTHFGGRLLATAGTWF
CNDVFFYGNKLFQGQFIKVISDSPDSLMVTWSWNLVNITVSLAGYYLASLLIDNKLYGRKMMQQVGFFMCFLMFV
IPAMQYEKYTKPQNIHAFQAMYFISSFFNQFGPNSVTFLVAGEVFPTPVRATAHGFSACLGKAGALLASVLYNYI
DTRTKFYVVPWFGLAGMLLTWLFLPDTTGLDLKEQERRWNYIRQGRADDYHGVAVNPAHLSLWERMRGISKTYDP
DLDLRSKIQDMRAAWETVQKTRGPRDSEDQDSHGMPEDGEFSQEIHDYFKRSATTPNTVSEKAPSR
Coding >Ophio5|3791
ATGGCGCTCAAAGACGATTCCTTGCCAGAAACGGCAATCCATCAGCGCCACCATCGCCACACGCCTGTTGTTCCC
GGCCAAGTTCTCGTCCCCTACGGCCCGCCTACGGATTCCGATAGCGACGACTATGGCCTGGCCGTCGGCAACCGT
GACGAGCGCCGCATATTCAGCCACATTACTCGCCCCGACGACTGCTACACCCCCGAAGGCGTCTACTGGGCAGAC
CTGCCATGGGCTGACCGCGTTACCTTTGTTTCGCGCGTCGACCGCCGTGTCACCGCTCAAGAATTCCGCTCTCTC
GGCTCCATGATCAAAAAGGACCCCTTATCACCCCTTTCTTGGTACTTCCGTCACGCCGTCGTCCCCGGCGCCGGC
CTCGGCCTTGAGGGTTACGTCCTTTTCTCCATTGGTAACCTGGAACCTCTTTTCAGACAAGTTTGGCCGCAATGC
TGGGATAAGTACCAGGTTTGCGGCCAGAATTGGGTTGCCAGCGTCACCTATTTGGAGATTATCGGCATCATGGTC
GGCCAGGCCGCCGTCGGTGTCATCGGTGATTGGATCGGTCGCCGCTGGGGTCTTATCCAGGATGCCCTCATCATG
CTCATCGGCCTGCTGATGTTGACCGCCAGCTGGGGCCTCACGCTCGAGGGTTGGGTCATTTGTTATGCCTGGTCT
CTGTTCTTCTACAGTCTCGGCGTCGGGGGCGAGTATCCCATCACCGCCACCTCGTCCCTCGAGGGCGCCGACACC
GCTGGCAAGCTGTCTACGCGCGAGGACCGCCTGCACCGTGGCCGCCGTGTCACCATGGCCTTCCTGATGCAAGGA
TGGGGCCAATTCGTCAACCAGGTCCTCCTCATGGCCCTGCTCGTCATCTTCAACAAGGGCAGCGGCAGTCCGCCC
TACAGCAACTCGTCGGCCCAGTTCGCCTTCCGACTGTCCTTTGCCTTTCCCGCAGTCGGCACCGCCTGGCTCGTC
TACTACCGCACCTGGAAGATGCCTCACGCATCCAGGCAGCTTGCCGACGCCAAGAGTCGCTCTAACGTGACTGGC
TACGACGTTCGCGCTCTCAGCTACTGCTTTACTCACTTCGGCGGCCGCCTCCTCGCCACTGCTGGCACCTGGTTC
TGCAACGACGTCTTCTTCTACGGCAACAAGCTCTTCCAGGGCCAATTTATCAAGGTCATCTCCGACAGCCCCGAC
TCGCTCATGGTCACCTGGTCCTGGAACCTGGTCAACATCACCGTTTCCCTGGCCGGCTACTACCTCGCCTCGCTC
CTCATCGACAATAAGCTCTACGGCAGAAAGATGATGCAGCAGGTCGGCTTCTTCATGTGCTTCCTCATGTTCGTT
ATCCCGGCCATGCAGTACGAAAAGTACACCAAGCCCCAAAACATCCACGCCTTCCAGGCCATGTACTTCATCTCC
TCCTTTTTCAACCAGTTCGGCCCCAACTCGGTCACCTTCCTCGTCGCCGGTGAAGTCTTCCCCACTCCCGTCCGT
GCCACCGCCCACGGCTTCTCCGCCTGCTTGGGGAAGGCCGGCGCCCTGCTCGCTTCGGTGCTCTACAACTACATC
GACACTCGCACCAAGTTCTACGTGGTCCCCTGGTTCGGCCTTGCCGGCATGTTGCTCACCTGGCTTTTCCTCCCG
GACACGACGGGCCTGGATCTCAAGGAACAGGAGCGCCGCTGGAACTACATCCGCCAGGGCCGGGCCGACGACTAC
CATGGCGTCGCCGTGAACCCCGCCCATCTCAGCCTATGGGAACGGATGCGCGGCATTAGCAAGACTTATGACCCC
GACTTGGACTTGAGGTCCAAGATCCAAGACATGCGCGCCGCGTGGGAGACCGTTCAGAAGACCCGCGGCCCTAGG
GATAGCGAGGACCAAGACAGCCACGGTATGCCCGAGGACGGCGAGTTTTCTCAGGAGATTCACGACTACTTTAAG
CGCTCCGCTACAACACCCAACACAGTGAGCGAGAAGGCGCCGTCGCGA
Transcript >Ophio5|3791
ATGGCGCTCAAAGACGATTCCTTGCCAGAAACGGCAATCCATCAGCGCCACCATCGCCACACGCCTGTTGTTCCC
GGCCAAGTTCTCGTCCCCTACGGCCCGCCTACGGATTCCGATAGCGACGACTATGGCCTGGCCGTCGGCAACCGT
GACGAGCGCCGCATATTCAGCCACATTACTCGCCCCGACGACTGCTACACCCCCGAAGGCGTCTACTGGGCAGAC
CTGCCATGGGCTGACCGCGTTACCTTTGTTTCGCGCGTCGACCGCCGTGTCACCGCTCAAGAATTCCGCTCTCTC
GGCTCCATGATCAAAAAGGACCCCTTATCACCCCTTTCTTGGTACTTCCGTCACGCCGTCGTCCCCGGCGCCGGC
CTCGGCCTTGAGGGTTACGTCCTTTTCTCCATTGGTAACCTGGAACCTCTTTTCAGACAAGTTTGGCCGCAATGC
TGGGATAAGTACCAGGTTTGCGGCCAGAATTGGGTTGCCAGCGTCACCTATTTGGAGATTATCGGCATCATGGTC
GGCCAGGCCGCCGTCGGTGTCATCGGTGATTGGATCGGTCGCCGCTGGGGTCTTATCCAGGATGCCCTCATCATG
CTCATCGGCCTGCTGATGTTGACCGCCAGCTGGGGCCTCACGCTCGAGGGTTGGGTCATTTGTTATGCCTGGTCT
CTGTTCTTCTACAGTCTCGGCGTCGGGGGCGAGTATCCCATCACCGCCACCTCGTCCCTCGAGGGCGCCGACACC
GCTGGCAAGCTGTCTACGCGCGAGGACCGCCTGCACCGTGGCCGCCGTGTCACCATGGCCTTCCTGATGCAAGGA
TGGGGCCAATTCGTCAACCAGGTCCTCCTCATGGCCCTGCTCGTCATCTTCAACAAGGGCAGCGGCAGTCCGCCC
TACAGCAACTCGTCGGCCCAGTTCGCCTTCCGACTGTCCTTTGCCTTTCCCGCAGTCGGCACCGCCTGGCTCGTC
TACTACCGCACCTGGAAGATGCCTCACGCATCCAGGCAGCTTGCCGACGCCAAGAGTCGCTCTAACGTGACTGGC
TACGACGTTCGCGCTCTCAGCTACTGCTTTACTCACTTCGGCGGCCGCCTCCTCGCCACTGCTGGCACCTGGTTC
TGCAACGACGTCTTCTTCTACGGCAACAAGCTCTTCCAGGGCCAATTTATCAAGGTCATCTCCGACAGCCCCGAC
TCGCTCATGGTCACCTGGTCCTGGAACCTGGTCAACATCACCGTTTCCCTGGCCGGCTACTACCTCGCCTCGCTC
CTCATCGACAATAAGCTCTACGGCAGAAAGATGATGCAGCAGGTCGGCTTCTTCATGTGCTTCCTCATGTTCGTT
ATCCCGGCCATGCAGTACGAAAAGTACACCAAGCCCCAAAACATCCACGCCTTCCAGGCCATGTACTTCATCTCC
TCCTTTTTCAACCAGTTCGGCCCCAACTCGGTCACCTTCCTCGTCGCCGGTGAAGTCTTCCCCACTCCCGTCCGT
GCCACCGCCCACGGCTTCTCCGCCTGCTTGGGGAAGGCCGGCGCCCTGCTCGCTTCGGTGCTCTACAACTACATC
GACACTCGCACCAAGTTCTACGTGGTCCCCTGGTTCGGCCTTGCCGGCATGTTGCTCACCTGGCTTTTCCTCCCG
GACACGACGGGCCTGGATCTCAAGGAACAGGAGCGCCGCTGGAACTACATCCGCCAGGGCCGGGCCGACGACTAC
CATGGCGTCGCCGTGAACCCCGCCCATCTCAGCCTATGGGAACGGATGCGCGGCATTAGCAAGACTTATGACCCC
GACTTGGACTTGAGGTCCAAGATCCAAGACATGCGCGCCGCGTGGGAGACCGTTCAGAAGACCCGCGGCCCTAGG
GATAGCGAGGACCAAGACAGCCACGGTATGCCCGAGGACGGCGAGTTTTCTCAGGAGATTCACGACTACTTTAAG
CGCTCCGCTACAACACCCAACACAGTGAGCGAGAAGGCGCCGTCGCGATGA
Gene >Ophio5|3791
ATGGCGCTCAAAGACGATTCCTTGCCAGAAACGGCAATCCATCAGCGCCACCATCGCCACACGCCTGTTGTTCCC
GGCCAAGTTCTCGTCCCCTACGGCCCGCCTACGGATTCCGATAGCGACGACTATGGCCTGGCCGTCGGCAACCGT
GACGAGCGCCGCATATTCAGCCACATTACTCGCCCCGACGACTGCTACACCCCCGAAGGCGTCTACTGGGCAGAC
CTGCCATGGGCTGACCGCGTTACCTTTGTTTCGCGCGTCGACCGCCGTGTCACCGCTCAAGAATTCCGCTCTCTC
GGCTCCATGATCAAAAAGGACCCCTTATCACCCCTTTCTTGGTACTTCCGTCACGCCGTCGTCCCCGGCGCCGGC
CTCGGCCTTGAGGGTTACGTCCTTTTCTCCATTGGTAACCTGGAACCTCTTTTCAGACAAGTTTGGCCGCAATGC
TGGGATAAGTACCAGGTTTGCGGCCAGAATTGGGTTGCCAGCGTCACCTATTTGGAGATTATCGGCATCATGGTC
GGCCAGGCCGCCGTCGGTGTAGGCCCCCCTTCCCACCACCGCTGCGTCCTCAGCAAAGGCATTCCAAGCCCGGAT
GCAATCCCGCATGGCTGACATGACGCCTTTCCCGCCCAGGTCATCGGTGATTGGATCGGTCGCCGCTGGGGTCTT
ATCCAGGATGCCCTCATCATGCTCATCGGCCTGCTGATGTTGACCGCCAGCTGGGGCCTCACGCTCGAGGGTTGG
GTCATTTGTTATGCCTGGTCTCTGTTCTTCTACAGTACGTCGCCATCCCCCTCAGTGTCTTCCTCGATGGCTTCT
GACCTAGCACCCTGCCAGGTCTCGGCGTCGGGGGCGAGTATCCCATCACCGCCACCTCGTCCCTCGAGGGCGCCG
ACACCGCTGGCAAGCTGTCTACGCGCGAGGACCGCCTGCACCGTGGCCGCCGTGTCACCATGGCCTTCCTGATGC
AAGGATGGGGCCAATTCGTCAACCAGGTCCTCCTCATGGCCCTGCTCGTCATCTTCAACAAGGGCAGCGGCAGTC
CGCCCTACAGCAACTCGTCGGCCCAGTTCGCCTTCCGACTGTCCTTTGCCTTTCCCGCAGTCGGCACCGCCTGGC
TCGTCTACTACCGCACCTGGAAGATGCCTCACGCATCCAGGCAGCTTGCCGACGCCAAGAGTCGCTCTAACGTGA
CTGGCTACGACGTTCGCGCTCTCAGCTACTGCTTTACTCACTTCGGCGGCCGCCTCCTCGCCACTGCTGGCACCT
GGTTCTGCAACGACGTCTTCTTCTACGGCAACAAGCTCTTCCAGGGCCAATTTATCAAGGTCATCTCCGACAGCC
CCGACTCGCTCATGGTCACCTGGTCCTGGAACCTGGTCAACATCACCGTTTCCCTGGCCGGCTACTACCTCGCCT
CGCTCCTCATCGACAATAAGCTCTACGGCAGAAAGATGATGCAGCAGGTCGGCTTCTTCATGTGCTTCCTCATGT
TCGTTATCCCGGCCATGCAGTACGAAAAGTACACCAAGCCCCAAAACATCCACGCCTTCCAGGCCATGTACTTCA
TCTCCTCCTTTTTCAACCAGTTCGGCCCCAACTCGGTCACCTTCCTCGTCGCCGGTGAAGTCTTCCCCACTCCCG
TCCGTGCCACCGCCCACGGCTTCTCCGCCTGCTTGGGGAAGGCCGGCGCCCTGCTCGCTTCGGTGCTCTACAACT
ACATCGACACTCGCACCAAGTTCTACGTGGTCCCCTGGTTCGGCCTTGCCGGCATGTTGCTCACCTGGCTTTTCC
TCCCGGACACGACGGGCCTGGATCTCAAGGAACAGGAGCGCCGCTGGAACTACATCCGCCAGGGCCGGGCCGACG
ACTACCATGGCGTCGCCGTGAACCCCGCCCATCTCAGCCTATGGGAACGGATGCGCGGCATTAGCAAGACTTATG
ACCCCGACTTGGACTTGAGGTCCAAGATCCAAGACATGCGCGCCGCGTGGGAGACCGTTCAGAAGACCCGCGGCC
CTAGGGATAGCGAGGACCAAGACAGCCACGGTATGCCCGAGGACGGCGAGTTTTCTCAGGAGATTCACGACTACT
TTAAGCGCTCCGCTACAACACCCAACACAGTGAGCGAGAAGGCGCCGTCGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail