Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3787
Gene name
Locationscaffold_299:16609..17368
Strand+
Gene length (bp)759
Transcript length (bp)759
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96NY7|CLIC6_HUMAN Chloride intracellular channel protein 6 OS=Homo sapiens GN=CLIC6 PE=2 SV=3 61 123 5.0E-08
sp|P53353|ASPX_VULVU Sperm acrosomal protein FSA-ACR.1 (Fragment) OS=Vulpes vulpes PE=2 SV=1 59 127 6.0E-08
sp|P53353|ASPX_VULVU Sperm acrosomal protein FSA-ACR.1 (Fragment) OS=Vulpes vulpes PE=2 SV=1 49 122 8.0E-07
sp|Q96NY7|CLIC6_HUMAN Chloride intracellular channel protein 6 OS=Homo sapiens GN=CLIC6 PE=2 SV=3 52 123 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3787
MKNTACLLFALAGLAAAAPPQHKPTSTNPWSAQHGPSTNKSSVAPVVSPSTRPDLKKLAAAEGPAGKTSVAEGPA
GKSSVAEGPAGKSSVAERPAGKSSVAEGPAGKSSIAEGPAGNSSVAKGSGRKYEVMMKFKNCGKNDNRNAEDVVK
DKTCEVEAVYRRADPNSKAKGETADTISPASSASPGAHGSSEDITGSSSPPPVSGDSGDMSKPKKSSSSAKEKLN
SVQGEKKIKQAEKGPKTFPGSKPESGA
Coding >Ophio5|3787
ATGAAGAACACCGCTTGCCTCCTTTTCGCCCTTGCTGGGCTGGCCGCTGCCGCGCCTCCACAACACAAACCTACA
TCGACAAATCCATGGAGTGCGCAGCATGGGCCATCGACAAATAAAAGCTCTGTTGCTCCAGTTGTGTCGCCCTCC
ACGCGTCCGGACTTGAAGAAGCTCGCAGCTGCTGAGGGACCGGCCGGGAAGACCTCGGTCGCTGAGGGACCGGCC
GGGAAGTCCTCGGTTGCTGAGGGACCGGCTGGGAAGTCCTCGGTCGCTGAGAGACCGGCCGGGAAGTCCTCGGTC
GCTGAGGGACCGGCCGGAAAGTCCTCAATCGCTGAGGGACCGGCCGGAAACTCCTCGGTCGCTAAGGGCTCGGGC
CGGAAATATGAAGTTATGATGAAGTTTAAAAACTGCGGTAAAAACGATAACCGCAACGCGGAAGACGTCGTGAAA
GATAAAACATGCGAAGTCGAGGCGGTTTATCGAAGGGCTGACCCAAATTCTAAGGCAAAGGGTGAGACAGCAGAC
ACTATCTCGCCTGCAAGTTCCGCGAGCCCGGGGGCCCATGGTTCATCCGAGGACATCACCGGCTCATCATCACCT
CCCCCAGTTTCCGGCGATAGTGGCGACATGAGCAAACCCAAAAAAAGTTCTTCATCGGCCAAAGAAAAGCTCAAC
TCCGTCCAAGGGGAGAAAAAAATAAAGCAGGCGGAGAAAGGCCCGAAGACGTTCCCAGGATCCAAGCCTGAATCG
GGCGCG
Transcript >Ophio5|3787
ATGAAGAACACCGCTTGCCTCCTTTTCGCCCTTGCTGGGCTGGCCGCTGCCGCGCCTCCACAACACAAACCTACA
TCGACAAATCCATGGAGTGCGCAGCATGGGCCATCGACAAATAAAAGCTCTGTTGCTCCAGTTGTGTCGCCCTCC
ACGCGTCCGGACTTGAAGAAGCTCGCAGCTGCTGAGGGACCGGCCGGGAAGACCTCGGTCGCTGAGGGACCGGCC
GGGAAGTCCTCGGTTGCTGAGGGACCGGCTGGGAAGTCCTCGGTCGCTGAGAGACCGGCCGGGAAGTCCTCGGTC
GCTGAGGGACCGGCCGGAAAGTCCTCAATCGCTGAGGGACCGGCCGGAAACTCCTCGGTCGCTAAGGGCTCGGGC
CGGAAATATGAAGTTATGATGAAGTTTAAAAACTGCGGTAAAAACGATAACCGCAACGCGGAAGACGTCGTGAAA
GATAAAACATGCGAAGTCGAGGCGGTTTATCGAAGGGCTGACCCAAATTCTAAGGCAAAGGGTGAGACAGCAGAC
ACTATCTCGCCTGCAAGTTCCGCGAGCCCGGGGGCCCATGGTTCATCCGAGGACATCACCGGCTCATCATCACCT
CCCCCAGTTTCCGGCGATAGTGGCGACATGAGCAAACCCAAAAAAAGTTCTTCATCGGCCAAAGAAAAGCTCAAC
TCCGTCCAAGGGGAGAAAAAAATAAAGCAGGCGGAGAAAGGCCCGAAGACGTTCCCAGGATCCAAGCCTGAATCG
GGCGCGTGA
Gene >Ophio5|3787
ATGAAGAACACCGCTTGCCTCCTTTTCGCCCTTGCTGGGCTGGCCGCTGCCGCGCCTCCACAACACAAACCTACA
TCGACAAATCCATGGAGTGCGCAGCATGGGCCATCGACAAATAAAAGCTCTGTTGCTCCAGTTGTGTCGCCCTCC
ACGCGTCCGGACTTGAAGAAGCTCGCAGCTGCTGAGGGACCGGCCGGGAAGACCTCGGTCGCTGAGGGACCGGCC
GGGAAGTCCTCGGTTGCTGAGGGACCGGCTGGGAAGTCCTCGGTCGCTGAGAGACCGGCCGGGAAGTCCTCGGTC
GCTGAGGGACCGGCCGGAAAGTCCTCAATCGCTGAGGGACCGGCCGGAAACTCCTCGGTCGCTAAGGGCTCGGGC
CGGAAATATGAAGTTATGATGAAGTTTAAAAACTGCGGTAAAAACGATAACCGCAACGCGGAAGACGTCGTGAAA
GATAAAACATGCGAAGTCGAGGCGGTTTATCGAAGGGCTGACCCAAATTCTAAGGCAAAGGGTGAGACAGCAGAC
ACTATCTCGCCTGCAAGTTCCGCGAGCCCGGGGGCCCATGGTTCATCCGAGGACATCACCGGCTCATCATCACCT
CCCCCAGTTTCCGGCGATAGTGGCGACATGAGCAAACCCAAAAAAAGTTCTTCATCGGCCAAAGAAAAGCTCAAC
TCCGTCCAAGGGGAGAAAAAAATAAAGCAGGCGGAGAAAGGCCCGAAGACGTTCCCAGGATCCAAGCCTGAATCG
GGCGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail