Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3783
Gene name
Locationscaffold_299:7892..9867
Strand-
Gene length (bp)1975
Transcript length (bp)1923
Coding sequence length (bp)1920
Protein length (aa) 640

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10637 Ofd1_CTDD Oxoglutarate and iron-dependent oxygenase degradation C-term 4.6E-88 326 611
PF13661 2OG-FeII_Oxy_4 2OG-Fe(II) oxygenase superfamily 9.9E-29 151 269
PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily 6.2E-13 152 269

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q11120|OFD1_SCHPO Prolyl 3,4-dihydroxylase ofd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ofd1 PE=1 SV=1 26 601 8.0E-132
sp|P40032|TPA1_YEAST Prolyl 3,4-dihydroxylase TPA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPA1 PE=1 SV=1 1 612 3.0E-112
sp|Q01F03|OGFD1_OSTTA Prolyl 3,4-dihydroxylase OGFOD1 OS=Ostreococcus tauri GN=Ogd PE=1 SV=1 57 601 7.0E-68
sp|Q5R4R3|OGFD1_PONAB Prolyl 3-hydroxylase OGFOD1 OS=Pongo abelii GN=OGFOD1 PE=2 SV=1 58 605 3.0E-29
sp|Q8N543|OGFD1_HUMAN Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens GN=OGFOD1 PE=1 SV=1 58 605 6.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q11120|OFD1_SCHPO Prolyl 3,4-dihydroxylase ofd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ofd1 PE=1 SV=1 26 601 8.0E-132
sp|P40032|TPA1_YEAST Prolyl 3,4-dihydroxylase TPA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPA1 PE=1 SV=1 1 612 3.0E-112
sp|Q01F03|OGFD1_OSTTA Prolyl 3,4-dihydroxylase OGFOD1 OS=Ostreococcus tauri GN=Ogd PE=1 SV=1 57 601 7.0E-68
sp|Q5R4R3|OGFD1_PONAB Prolyl 3-hydroxylase OGFOD1 OS=Pongo abelii GN=OGFOD1 PE=2 SV=1 58 605 3.0E-29
sp|Q8N543|OGFD1_HUMAN Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens GN=OGFOD1 PE=1 SV=1 58 605 6.0E-28
sp|Q3MI03|OGFD1_BOVIN Prolyl 3-hydroxylase OGFOD1 OS=Bos taurus GN=OGFOD1 PE=2 SV=2 2 368 1.0E-25
sp|Q3U0K8|OGFD1_MOUSE Prolyl 3-hydroxylase OGFOD1 OS=Mus musculus GN=Ogfod1 PE=1 SV=1 2 368 2.0E-24
sp|Q6DE73|OGFD1_XENLA Prolyl 3-hydroxylase OGFOD1 OS=Xenopus laevis GN=ogfod1 PE=2 SV=1 56 379 2.0E-23
sp|Q9I7H9|OGFD1_DROME Prolyl 3-hydroxylase sudestada1 OS=Drosophila melanogaster GN=sud1 PE=2 SV=1 56 473 4.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0031418 L-ascorbic acid binding Yes
GO:0016706 2-oxoglutarate-dependent dioxygenase activity Yes
GO:0019842 vitamin binding No
GO:0043168 anion binding No
GO:0051213 dioxygenase activity No
GO:0016491 oxidoreductase activity No
GO:0031406 carboxylic acid binding No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0005488 binding No
GO:0030246 carbohydrate binding No
GO:1901363 heterocyclic compound binding No
GO:0043177 organic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0046914 transition metal ion binding No
GO:0048029 monosaccharide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3783
MKRKADSQADGRSQASSKKTKTTKNDAKDKDVRRRFRAGLFEKPVLASYSKEYAASSPYKHAVIHDLVDDALLRS
VRDEIRANVQFSPKETDIYKIHQSGDLANLDGLDDESMAKLPSLRALRDAVYSDAFRSYVSAITGCGPLSGRKTD
MAINVYTPGCYLLCHDDVIGSRRVSYILYLTDPDKPWRPEWGGALRLFPVQELRGKDGQVAKTPLPEPVKVIPPA
WNQLSFFAVQPGESFHDVEEVFHAKPGADDDGGRVRMAISGWFHIPQAGEQGYVEGEEERNAENSSLMQLQGDPA
QYDVPCPRPLAVDNPSTNQQGFDEADLEFLLKYMAPTYLTPDTLEQVSDHFSETSSISLANVLSNKFARRLKQYL
AAQELLPMPGTSADMETKSPWRVARPPHKHRYLFQQPSGPDQLRTSQEESPITELLDIFLPSRQFRYWLQMATDC
VVESCDLTARRFRRGQDYTLATGHDGRPRLELNLGITPTSGWGDDDDNEEAEVQDKGKGKGKGKGKAKAKAKADR
DADGDHDVGGHEVYMAGDDGDDADDAAVYKSSGEDDNILFFQAAAWNKMTLVLRDSGTLRFVKYVSSKAPGDRWD
VSGVFEVEDEDAAAAPGGESEDEEEFNGFSDPISSESDSD
Coding >Ophio5|3783
ATGAAGAGAAAAGCAGACAGTCAGGCTGATGGCCGATCCCAGGCCAGCAGCAAGAAAACAAAGACGACCAAGAAC
GACGCCAAAGACAAGGACGTCAGGCGGCGGTTTCGCGCCGGCCTGTTTGAAAAGCCCGTTCTCGCCTCCTACAGC
AAAGAGTATGCGGCGTCATCGCCATACAAACATGCCGTCATCCATGACCTCGTTGATGACGCGCTGCTGCGCTCC
GTGAGAGACGAGATCCGAGCCAACGTCCAGTTTTCACCCAAGGAGACGGACATCTACAAGATCCACCAGTCCGGA
GATCTCGCCAATCTCGACGGCCTCGATGACGAATCCATGGCCAAGCTTCCCTCTCTGCGCGCCCTGCGTGACGCC
GTCTACTCCGACGCCTTTAGGAGCTACGTCTCCGCCATCACCGGCTGCGGCCCCCTAAGCGGCCGCAAGACGGAC
ATGGCCATCAATGTTTACACCCCCGGATGCTATCTCCTCTGTCACGACGACGTCATTGGGAGCCGCCGTGTTAGC
TACATCCTCTACTTGACCGACCCAGACAAGCCGTGGCGGCCCGAGTGGGGGGGCGCCCTCCGCCTGTTCCCCGTC
CAGGAGTTACGGGGTAAGGACGGCCAGGTGGCCAAGACGCCTCTCCCTGAACCCGTCAAGGTCATCCCTCCGGCC
TGGAACCAGCTCAGCTTCTTCGCTGTTCAGCCCGGCGAGAGCTTCCACGATGTCGAGGAGGTCTTTCACGCCAAG
CCCGGCGCAGACGACGATGGCGGCCGTGTCCGAATGGCCATCAGCGGCTGGTTCCACATCCCACAGGCCGGAGAG
CAGGGCTATGTCGAGGGCGAGGAGGAGAGAAATGCCGAAAACAGCAGCCTGATGCAGCTTCAGGGCGACCCGGCG
CAGTACGACGTCCCCTGTCCTCGGCCCCTCGCCGTCGACAATCCCAGCACCAACCAGCAAGGCTTTGATGAGGCC
GACTTGGAGTTTTTGCTCAAGTACATGGCGCCGACCTACCTGACGCCCGACACTCTCGAGCAGGTCTCGGACCAC
TTCAGCGAGACCTCTAGCATCTCGCTCGCCAACGTCCTGTCCAACAAGTTTGCGCGCCGCCTCAAGCAGTATCTC
GCGGCTCAGGAGTTGCTGCCAATGCCCGGGACCAGCGCCGACATGGAGACGAAGTCGCCGTGGCGGGTGGCGAGG
CCGCCGCACAAGCACCGATATCTCTTTCAGCAGCCCAGCGGCCCGGACCAGCTGCGCACATCGCAAGAGGAGTCA
CCTATCACTGAGCTTCTCGACATATTTCTGCCGAGTCGTCAGTTCCGATACTGGTTGCAGATGGCCACGGACTGT
GTCGTCGAGAGCTGTGACCTCACGGCCCGCCGCTTCCGTCGGGGCCAGGATTATACACTCGCCACCGGCCACGAC
GGCAGACCTCGTCTGGAACTCAATCTGGGCATCACCCCGACCTCGGGCTGGGGTGACGATGACGATAATGAAGAG
GCCGAAGTGCAAGACAAGGGCAAGGGCAAGGGCAAGGGCAAGGGCAAGGCCAAAGCAAAGGCCAAAGCCGATAGG
GACGCGGATGGCGACCACGATGTAGGCGGTCACGAGGTGTACATGGCCGGCGATGACGGCGACGATGCCGACGAC
GCTGCCGTCTACAAGTCCAGCGGCGAGGACGACAACATTCTCTTCTTCCAGGCCGCTGCTTGGAACAAGATGACC
CTCGTCCTGCGCGACAGCGGCACTCTGCGCTTCGTCAAGTACGTCAGCAGCAAGGCTCCGGGGGACCGGTGGGAC
GTCTCTGGCGTGTTCGAAGTCGAGGACGAAGACGCCGCCGCGGCGCCGGGTGGCGAGTCTGAAGACGAGGAGGAG
TTTAATGGCTTCTCGGACCCTATTTCCAGCGAAAGCGATAGCGAT
Transcript >Ophio5|3783
ATGAAGAGAAAAGCAGACAGTCAGGCTGATGGCCGATCCCAGGCCAGCAGCAAGAAAACAAAGACGACCAAGAAC
GACGCCAAAGACAAGGACGTCAGGCGGCGGTTTCGCGCCGGCCTGTTTGAAAAGCCCGTTCTCGCCTCCTACAGC
AAAGAGTATGCGGCGTCATCGCCATACAAACATGCCGTCATCCATGACCTCGTTGATGACGCGCTGCTGCGCTCC
GTGAGAGACGAGATCCGAGCCAACGTCCAGTTTTCACCCAAGGAGACGGACATCTACAAGATCCACCAGTCCGGA
GATCTCGCCAATCTCGACGGCCTCGATGACGAATCCATGGCCAAGCTTCCCTCTCTGCGCGCCCTGCGTGACGCC
GTCTACTCCGACGCCTTTAGGAGCTACGTCTCCGCCATCACCGGCTGCGGCCCCCTAAGCGGCCGCAAGACGGAC
ATGGCCATCAATGTTTACACCCCCGGATGCTATCTCCTCTGTCACGACGACGTCATTGGGAGCCGCCGTGTTAGC
TACATCCTCTACTTGACCGACCCAGACAAGCCGTGGCGGCCCGAGTGGGGGGGCGCCCTCCGCCTGTTCCCCGTC
CAGGAGTTACGGGGTAAGGACGGCCAGGTGGCCAAGACGCCTCTCCCTGAACCCGTCAAGGTCATCCCTCCGGCC
TGGAACCAGCTCAGCTTCTTCGCTGTTCAGCCCGGCGAGAGCTTCCACGATGTCGAGGAGGTCTTTCACGCCAAG
CCCGGCGCAGACGACGATGGCGGCCGTGTCCGAATGGCCATCAGCGGCTGGTTCCACATCCCACAGGCCGGAGAG
CAGGGCTATGTCGAGGGCGAGGAGGAGAGAAATGCCGAAAACAGCAGCCTGATGCAGCTTCAGGGCGACCCGGCG
CAGTACGACGTCCCCTGTCCTCGGCCCCTCGCCGTCGACAATCCCAGCACCAACCAGCAAGGCTTTGATGAGGCC
GACTTGGAGTTTTTGCTCAAGTACATGGCGCCGACCTACCTGACGCCCGACACTCTCGAGCAGGTCTCGGACCAC
TTCAGCGAGACCTCTAGCATCTCGCTCGCCAACGTCCTGTCCAACAAGTTTGCGCGCCGCCTCAAGCAGTATCTC
GCGGCTCAGGAGTTGCTGCCAATGCCCGGGACCAGCGCCGACATGGAGACGAAGTCGCCGTGGCGGGTGGCGAGG
CCGCCGCACAAGCACCGATATCTCTTTCAGCAGCCCAGCGGCCCGGACCAGCTGCGCACATCGCAAGAGGAGTCA
CCTATCACTGAGCTTCTCGACATATTTCTGCCGAGTCGTCAGTTCCGATACTGGTTGCAGATGGCCACGGACTGT
GTCGTCGAGAGCTGTGACCTCACGGCCCGCCGCTTCCGTCGGGGCCAGGATTATACACTCGCCACCGGCCACGAC
GGCAGACCTCGTCTGGAACTCAATCTGGGCATCACCCCGACCTCGGGCTGGGGTGACGATGACGATAATGAAGAG
GCCGAAGTGCAAGACAAGGGCAAGGGCAAGGGCAAGGGCAAGGGCAAGGCCAAAGCAAAGGCCAAAGCCGATAGG
GACGCGGATGGCGACCACGATGTAGGCGGTCACGAGGTGTACATGGCCGGCGATGACGGCGACGATGCCGACGAC
GCTGCCGTCTACAAGTCCAGCGGCGAGGACGACAACATTCTCTTCTTCCAGGCCGCTGCTTGGAACAAGATGACC
CTCGTCCTGCGCGACAGCGGCACTCTGCGCTTCGTCAAGTACGTCAGCAGCAAGGCTCCGGGGGACCGGTGGGAC
GTCTCTGGCGTGTTCGAAGTCGAGGACGAAGACGCCGCCGCGGCGCCGGGTGGCGAGTCTGAAGACGAGGAGGAG
TTTAATGGCTTCTCGGACCCTATTTCCAGCGAAAGCGATAGCGATTGA
Gene >Ophio5|3783
ATGAAGAGAAAAGCAGACAGTCAGGCTGATGGCCGATCCCAGGCCAGCAGCAAGAAAACAAAGACGAGTTGCGTT
GCTCATGTTGCCCCAATGCCCCATTGATCTGACCGGCTTTCCAGCCAAGAACGACGCCAAAGACAAGGACGTCAG
GCGGCGGTTTCGCGCCGGCCTGTTTGAAAAGCCCGTTCTCGCCTCCTACAGCAAAGAGTATGCGGCGTCATCGCC
ATACAAACATGCCGTCATCCATGACCTCGTTGATGACGCGCTGCTGCGCTCCGTGAGAGACGAGATCCGAGCCAA
CGTCCAGTTTTCACCCAAGGAGACGGACATCTACAAGATCCACCAGTCCGGAGATCTCGCCAATCTCGACGGCCT
CGATGACGAATCCATGGCCAAGCTTCCCTCTCTGCGCGCCCTGCGTGACGCCGTCTACTCCGACGCCTTTAGGAG
CTACGTCTCCGCCATCACCGGCTGCGGCCCCCTAAGCGGCCGCAAGACGGACATGGCCATCAATGTTTACACCCC
CGGATGCTATCTCCTCTGTCACGACGACGTCATTGGGAGCCGCCGTGTTAGCTACATCCTCTACTTGACCGACCC
AGACAAGCCGTGGCGGCCCGAGTGGGGGGGCGCCCTCCGCCTGTTCCCCGTCCAGGAGTTACGGGGTAAGGACGG
CCAGGTGGCCAAGACGCCTCTCCCTGAACCCGTCAAGGTCATCCCTCCGGCCTGGAACCAGCTCAGCTTCTTCGC
TGTTCAGCCCGGCGAGAGCTTCCACGATGTCGAGGAGGTCTTTCACGCCAAGCCCGGCGCAGACGACGATGGCGG
CCGTGTCCGAATGGCCATCAGCGGCTGGTTCCACATCCCACAGGCCGGAGAGCAGGGCTATGTCGAGGGCGAGGA
GGAGAGAAATGCCGAAAACAGCAGCCTGATGCAGCTTCAGGGCGACCCGGCGCAGTACGACGTCCCCTGTCCTCG
GCCCCTCGCCGTCGACAATCCCAGCACCAACCAGCAAGGCTTTGATGAGGCCGACTTGGAGTTTTTGCTCAAGTA
CATGGCGCCGACCTACCTGACGCCCGACACTCTCGAGCAGGTCTCGGACCACTTCAGCGAGACCTCTAGCATCTC
GCTCGCCAACGTCCTGTCCAACAAGTTTGCGCGCCGCCTCAAGCAGTATCTCGCGGCTCAGGAGTTGCTGCCAAT
GCCCGGGACCAGCGCCGACATGGAGACGAAGTCGCCGTGGCGGGTGGCGAGGCCGCCGCACAAGCACCGATATCT
CTTTCAGCAGCCCAGCGGCCCGGACCAGCTGCGCACATCGCAAGAGGAGTCACCTATCACTGAGCTTCTCGACAT
ATTTCTGCCGAGTCGTCAGTTCCGATACTGGTTGCAGATGGCCACGGACTGTGTCGTCGAGAGCTGTGACCTCAC
GGCCCGCCGCTTCCGTCGGGGCCAGGATTATACACTCGCCACCGGCCACGACGGCAGACCTCGTCTGGAACTCAA
TCTGGGCATCACCCCGACCTCGGGCTGGGGTGACGATGACGATAATGAAGAGGCCGAAGTGCAAGACAAGGGCAA
GGGCAAGGGCAAGGGCAAGGGCAAGGCCAAAGCAAAGGCCAAAGCCGATAGGGACGCGGATGGCGACCACGATGT
AGGCGGTCACGAGGTGTACATGGCCGGCGATGACGGCGACGATGCCGACGACGCTGCCGTCTACAAGTCCAGCGG
CGAGGACGACAACATTCTCTTCTTCCAGGCCGCTGCTTGGAACAAGATGACCCTCGTCCTGCGCGACAGCGGCAC
TCTGCGCTTCGTCAAGTACGTCAGCAGCAAGGCTCCGGGGGACCGGTGGGACGTCTCTGGCGTGTTCGAAGTCGA
GGACGAAGACGCCGCCGCGGCGCCGGGTGGCGAGTCTGAAGACGAGGAGGAGTTTAATGGCTTCTCGGACCCTAT
TTCCAGCGAAAGCGATAGCGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail