Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3770
Gene name
Locationscaffold_298:853..3674
Strand+
Gene length (bp)2821
Transcript length (bp)1905
Coding sequence length (bp)1902
Protein length (aa) 634

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09362 DUF1996 Domain of unknown function (DUF1996) 1.7E-84 178 429

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2153 0.2463 0.8686 0.1628 0.0678 0.0121 0.1322 0.1254 0.0837 0.002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3939
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6175
Ophiocordyceps australis map64 (Brazil) OphauB2|1713
Ophiocordyceps camponoti-floridani Ophcf2|05319
Ophiocordyceps camponoti-rufipedis Ophun1|5818
Ophiocordyceps kimflemingae Ophio5|3770 (this protein)
Ophiocordyceps subramaniannii Hirsu2|784

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3770
MVRRRPVCSTKGRLVILAPPAHVLPGTEYAATGHRVLQGAGYCMAAAAIRNALSPADGCRRCRHLSFLKNPPANP
AFRRSLPLRRSKASIALSQTPGTAGDRWTCLYISLISDCLVASSFPFYRTLNSRLYVCAPAFYQPVNNIMKTTTT
TLCAAFVASANAFWRMECPGRVGLARIDPIVNPDEVSKHVHSIAGSSAFSENSNYTDLVNGKCTSCRVTQDKSSY
WHPALYFKDSNTNKYEVVEQVGGMLAYYLLNGDHITAFPPGFRMLSGNTDRTTYTLGDPSQPDPDKSAWASMGQT
NQKDLAQRAVGFNCLNYNKAPEGTLFRHFLPDKGYLDANCKDGVRFEIMFPSCWKGGDAVDSPNHQDHVAFPDLV
MTGSCPESHPKRLPGLLYEVIWNTAAFSNRQGKFVLSNGDSTGYGYHGDFMMGWDPAFLQEAVDTCTNPSGRIED
CPLFDIIDKNEACQCELEGPMPESVSKEDVKGPMAKLPGAGDGHEVKEKPAYEPKPTLKYTPGHKPTDPAAPLPG
DVFKQKLAQHAEAAVMPAMMNAEQAPAPAPAHTPAPAPTPAPESKSYYSTQYITNGNVVSKILLEAQTVYVSQYA
DQASAAPPAASADAASHQRRAAHVHRHAHFRRRQ
Coding >Ophio5|3770
ATGGTACGTCGGCGCCCAGTTTGCAGCACCAAGGGACGCCTCGTAATCTTGGCTCCTCCCGCACATGTCCTCCCT
GGCACAGAGTATGCTGCTACAGGGCACAGAGTGCTACAGGGCGCAGGCTACTGCATGGCGGCTGCAGCTATCCGC
AACGCCCTGAGTCCTGCCGATGGCTGCCGCCGCTGCCGACACCTGTCTTTTCTCAAGAACCCACCCGCCAACCCG
GCCTTCCGTCGTTCCCTTCCCCTCCGTCGGTCCAAAGCTTCAATTGCATTGAGTCAAACTCCAGGCACCGCTGGC
GACCGTTGGACCTGCCTGTACATATCTCTCATCTCTGACTGCCTGGTTGCGTCGTCCTTTCCTTTTTATCGCACT
CTGAACTCACGCCTCTACGTTTGCGCACCTGCTTTCTACCAGCCTGTGAACAACATCATGAAGACTACAACTACC
ACTCTTTGCGCGGCCTTCGTCGCCAGCGCCAACGCCTTTTGGCGCATGGAGTGTCCTGGCCGCGTTGGCCTCGCC
CGAATTGATCCCATTGTCAACCCCGACGAGGTCTCCAAACATGTTCACTCGATTGCTGGCTCCTCTGCCTTTTCC
GAAAACTCCAACTACACGGACCTTGTCAACGGCAAGTGTACGTCGTGCCGTGTCACGCAGGACAAGTCCTCGTAC
TGGCACCCTGCCCTCTACTTCAAGGACTCCAACACCAACAAGTACGAGGTTGTTGAACAGGTTGGCGGCATGCTC
GCCTATTACCTGCTCAACGGCGACCACATCACCGCCTTCCCACCCGGCTTCCGCATGCTGTCGGGAAATACGGAC
CGAACCACCTACACGCTGGGCGACCCCAGCCAGCCTGACCCGGACAAGTCGGCATGGGCCTCAATGGGCCAGACA
AACCAGAAGGACCTCGCTCAGCGAGCCGTTGGCTTCAACTGCCTCAACTACAACAAGGCCCCCGAGGGCACCCTG
TTCCGCCACTTTCTCCCCGACAAGGGGTACTTAGACGCCAACTGCAAGGACGGCGTCCGATTTGAGATTATGTTT
CCTTCCTGCTGGAAGGGAGGCGATGCGGTCGACAGCCCCAATCATCAGGACCACGTCGCCTTCCCCGATCTCGTC
ATGACCGGCTCTTGCCCCGAGAGCCACCCCAAGCGCTTGCCCGGTCTCCTCTACGAGGTCATCTGGAACACGGCA
GCGTTCAGCAACAGGCAGGGCAAGTTTGTTCTGTCCAACGGCGACTCGACTGGCTACGGATACCATGGGGATTTT
ATGATGGGCTGGGACCCGGCTTTCCTCCAGGAGGCCGTTGACACCTGCACCAACCCCTCTGGCCGGATCGAGGAC
TGCCCCTTGTTTGACATCATCGATAAGAACGAGGCCTGCCAGTGCGAGCTGGAAGGCCCGATGCCCGAGTCCGTC
TCAAAGGAAGACGTCAAGGGACCCATGGCGAAGTTGCCCGGCGCCGGAGACGGCCACGAGGTCAAGGAGAAGCCC
GCATACGAGCCGAAGCCGACGCTCAAGTATACGCCGGGACACAAGCCTACCGATCCCGCTGCCCCTCTCCCGGGC
GATGTCTTCAAGCAGAAGTTGGCGCAGCACGCCGAGGCGGCCGTGATGCCGGCCATGATGAACGCCGAACAGGCG
CCGGCACCGGCGCCGGCACACACGCCGGCTCCCGCCCCGACTCCCGCACCGGAGAGCAAGAGCTACTACAGCACG
CAGTACATCACCAACGGCAATGTCGTCAGCAAGATTCTCCTCGAGGCGCAGACAGTGTACGTTTCGCAGTACGCT
GACCAGGCCTCTGCCGCACCCCCAGCCGCCTCGGCAGACGCTGCCTCTCACCAGCGCCGCGCCGCTCACGTGCAC
AGGCACGCGCACTTCCGGCGCAGACAA
Transcript >Ophio5|3770
ATGGTACGTCGGCGCCCAGTTTGCAGCACCAAGGGACGCCTCGTAATCTTGGCTCCTCCCGCACATGTCCTCCCT
GGCACAGAGTATGCTGCTACAGGGCACAGAGTGCTACAGGGCGCAGGCTACTGCATGGCGGCTGCAGCTATCCGC
AACGCCCTGAGTCCTGCCGATGGCTGCCGCCGCTGCCGACACCTGTCTTTTCTCAAGAACCCACCCGCCAACCCG
GCCTTCCGTCGTTCCCTTCCCCTCCGTCGGTCCAAAGCTTCAATTGCATTGAGTCAAACTCCAGGCACCGCTGGC
GACCGTTGGACCTGCCTGTACATATCTCTCATCTCTGACTGCCTGGTTGCGTCGTCCTTTCCTTTTTATCGCACT
CTGAACTCACGCCTCTACGTTTGCGCACCTGCTTTCTACCAGCCTGTGAACAACATCATGAAGACTACAACTACC
ACTCTTTGCGCGGCCTTCGTCGCCAGCGCCAACGCCTTTTGGCGCATGGAGTGTCCTGGCCGCGTTGGCCTCGCC
CGAATTGATCCCATTGTCAACCCCGACGAGGTCTCCAAACATGTTCACTCGATTGCTGGCTCCTCTGCCTTTTCC
GAAAACTCCAACTACACGGACCTTGTCAACGGCAAGTGTACGTCGTGCCGTGTCACGCAGGACAAGTCCTCGTAC
TGGCACCCTGCCCTCTACTTCAAGGACTCCAACACCAACAAGTACGAGGTTGTTGAACAGGTTGGCGGCATGCTC
GCCTATTACCTGCTCAACGGCGACCACATCACCGCCTTCCCACCCGGCTTCCGCATGCTGTCGGGAAATACGGAC
CGAACCACCTACACGCTGGGCGACCCCAGCCAGCCTGACCCGGACAAGTCGGCATGGGCCTCAATGGGCCAGACA
AACCAGAAGGACCTCGCTCAGCGAGCCGTTGGCTTCAACTGCCTCAACTACAACAAGGCCCCCGAGGGCACCCTG
TTCCGCCACTTTCTCCCCGACAAGGGGTACTTAGACGCCAACTGCAAGGACGGCGTCCGATTTGAGATTATGTTT
CCTTCCTGCTGGAAGGGAGGCGATGCGGTCGACAGCCCCAATCATCAGGACCACGTCGCCTTCCCCGATCTCGTC
ATGACCGGCTCTTGCCCCGAGAGCCACCCCAAGCGCTTGCCCGGTCTCCTCTACGAGGTCATCTGGAACACGGCA
GCGTTCAGCAACAGGCAGGGCAAGTTTGTTCTGTCCAACGGCGACTCGACTGGCTACGGATACCATGGGGATTTT
ATGATGGGCTGGGACCCGGCTTTCCTCCAGGAGGCCGTTGACACCTGCACCAACCCCTCTGGCCGGATCGAGGAC
TGCCCCTTGTTTGACATCATCGATAAGAACGAGGCCTGCCAGTGCGAGCTGGAAGGCCCGATGCCCGAGTCCGTC
TCAAAGGAAGACGTCAAGGGACCCATGGCGAAGTTGCCCGGCGCCGGAGACGGCCACGAGGTCAAGGAGAAGCCC
GCATACGAGCCGAAGCCGACGCTCAAGTATACGCCGGGACACAAGCCTACCGATCCCGCTGCCCCTCTCCCGGGC
GATGTCTTCAAGCAGAAGTTGGCGCAGCACGCCGAGGCGGCCGTGATGCCGGCCATGATGAACGCCGAACAGGCG
CCGGCACCGGCGCCGGCACACACGCCGGCTCCCGCCCCGACTCCCGCACCGGAGAGCAAGAGCTACTACAGCACG
CAGTACATCACCAACGGCAATGTCGTCAGCAAGATTCTCCTCGAGGCGCAGACAGTGTACGTTTCGCAGTACGCT
GACCAGGCCTCTGCCGCACCCCCAGCCGCCTCGGCAGACGCTGCCTCTCACCAGCGCCGCGCCGCTCACGTGCAC
AGGCACGCGCACTTCCGGCGCAGACAATGA
Gene >Ophio5|3770
ATGGTACGTCGGCGCCCAGTTTGCAGCACCAAGGGACGCCTCGTAATCTTGGCTCCTCCCGCACATGTCCTCCCT
GGCACAGAGTATGCTGCTACAGGGCACAGAGTGCTACAGGGCGCAGGCTACTGCATGGCGGCTGCAGCTATCCGC
AACGCCCTGAGTCCTGCCGATGGCTGCCGTACCTAAACAGGCCGTGTTCCCCTTCCTTCCTTGCTTTCCTTCCTG
GCCCTCTCTGTTCCGTTGGTTCCTTCCTTGTCCCGTTCCTTTTCGACTGTCCATCCTTCCTTCCTTTCGTCGTGA
GAGCGCACAGGTCAGGCCTTGATACCTTCATTCTCTCGTCTTCGCTCTCTTAGTTTTTTTTTGTCACTCTTTTCC
CTATCCCCTTTTCCCCTTCTCCCAGGCCGAATCACGACCGACGAGCAGAAAGGCCGGGCTTCCTCTGAGACGTCG
ACGTCAGCCTCGAGAAGCGGTGGCATTTCCACGTCGCCTGTTGCACCGACAACCCGCCGGCGTTGCCTTCTTTGT
TGACGCCAAACATCGCGTTGGAATTTCGACCGTCTCGCCTAGGCCGCTGCCGACACCTGTCTTTTCTCAAGAACC
CACCCGCCAACCCGGCCTTCCGTCGTTCCCTTCCCCTCCGTCGGTCCAAAGCTTCAATTGCATTGAGTCAAACTC
CAGGCACCGCTGGCGACCGTTGGACCTGCCTGTACATATCTCTCATCTCTGGTAAGTCGGACGACCCTGGTGATG
GATCCCCTGGACAACGGTGCTCGAGTGTCTGTCTGGAGCTGCCGCGACTCATGACGACCTCGCCTCGCTCGCGTC
CTCTCTTGCCCCCTGCTTCTCGCCTCTCTCACCTCGCTTCCCAACTCTATCAAGGCTCGGCCTGGAAGATGCGCG
AGCCACAGCAGGAAGCAGTGCTTGCCTTGCCCTCCATCCATACTCCCATCCTCTCCCGCATCCTTAGCATCATCG
TTAACCTCTCCGCCTGATCCTCCCGTCACTGCCCTTCTCCCGTCCTAGCCTCTTCACGCTCATCATTATTTCCTC
CTACTCGGCCCTCTGCCGACCGTCGCCACTAACTCGGTCTCTTTGTACTCGCTCAGACTGCCTGGTTGCGTCGTC
CTTTCCTTTTTATCGCACTCTGAACTCACGCCTCTACGTTTGCGCACCTGCTTTCTACCAGCCTGTGAACAACAT
CATGAAGACTACAACTACCACTCTTTGCGCGGCCTTCGTCGCCAGCGCCAACGCCTTTTGGCGCATGGAGTGTCC
TGGCCGCGTTGGCCTCGCCCGAATTGATCCCATTGTCAACCCCGACGAGGTCTCCAAACATGTTCACTCGATTGC
TGGCTCCTCTGGTCAGTCTTGCTGCCAAGTCTCAAGGTGGCAACTCCTAACCTGGCGCAGCCTTTTCCGAAAACT
CCAACTACACGGACCTTGTCAACGGCAAGTGTACGTCGTGCCGTGTCACGCAGGACAAGTCCTCGTACTGGCACC
CTGCCCTCTACTTCAAGGACTCCAACACCAACAAGTACGAGGTTGTTGAACAGGTTGGCGGCATGCTCGCGTAAG
TCTCCGCTTCTCATGTCGATCTTGAATCCTGACAACCGGCGCAGCTATTACCTGCTCAACGGCGACCACATCACC
GCCTTCCCACCCGGCTTCCGCATGCTGTCGGGAAATACGGACCGAACCACCTACACGCTGGGCGACCCCAGCCAG
CCTGACCCGGACAAGTCGGCATGGGCCTCAATGGGCCAGACAAACCAGAAGGACCTCGCTCAGCGAGCCGTTGGC
TTCAACTGCCTCAACTACAACAAGGCCCCCGAGGGCACCCTGTTCCGCCACTTTCTCCCCGACAAGGGGTACTTA
GACGCCAACTGCAAGGACGGCGTCCGATTTGAGATTATGTTTCCTTCCTGCTGGAAGGGAGGCGATGCGGTCGAC
AGCCCCAATCATCAGGACCACGTCGCCTTCCCCGATCTCGTCATGACCGGCTCTTGCCCCGAGAGCCACCCCAAG
CGCTTGCCCGGTCTCCTCTACGAGGTCATCTGGAACACGGCAGCGTTCAGCAACAGGCAGGGCAAGTTTGTTCTG
TCCAACGGCGACTCGACTGGTATGCAGATCCCTAGCCTTTCCCCTGCAATATAGTCTGACCCTCGCAGGCTACGG
ATACCATGGGGATTTTATGATGGGCTGGGACCCGGCTTTCCTCCAGGAGGCCGTTGACACCTGCACCAACCCCTC
TGGCCGGATCGAGGACTGCCCCTTGTTTGACATCATCGATAAGAACGAGGCCTGCCAGTGCGAGCTGGAAGGCCC
GATGCCCGAGTCCGTCTCAAAGGAAGACGTCAAGGGACCCATGGCGAAGTTGCCCGGCGCCGGAGACGGCCACGA
GGTCAAGGAGAAGCCCGCATACGAGCCGAAGCCGACGCTCAAGTATACGCCGGGACACAAGCCTACCGATCCCGC
TGCCCCTCTCCCGGGCGATGTCTTCAAGCAGAAGTTGGCGCAGCACGCCGAGGCGGCCGTGATGCCGGCCATGAT
GAACGCCGAACAGGCGCCGGCACCGGCGCCGGCACACACGCCGGCTCCCGCCCCGACTCCCGCACCGGAGAGCAA
GAGCTACTACAGCACGCAGTACATCACCAACGGCAATGTCGTCAGCAAGATTCTCCTCGAGGCGCAGACAGTGTA
CGTTTCGCAGTACGCTGACCAGGCCTCTGCCGCACCCCCAGCCGCCTCGGCAGACGCTGCCTCTCACCAGCGCCG
CGCCGCTCACGTGCACAGGCACGCGCACTTCCGGCGCAGACAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail