Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3769
Gene name
Locationscaffold_297:20298..22186
Strand+
Gene length (bp)1888
Transcript length (bp)1590
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P83740|SC5A6_DROME Putative sodium-dependent multivitamin transporter OS=Drosophila melanogaster GN=CG32669 PE=2 SV=1 14 213 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 10 29 19
2 49 71 22
3 81 103 22
4 124 143 19
5 163 185 22
6 192 209 17
7 229 251 22
8 272 294 22
9 314 336 22
10 357 374 17
11 379 401 22
12 413 435 22
13 459 481 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 65.64 35.72 95.57
CcL In ants, during behavior modification 5.87 1.63 10.11
CcD In ants, recently dead 8.58 3.20 13.96

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.258115 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3769
MGQPSVVASNAIIYTTYAAFLVLGTAVGWRMRGRARSTGELLSSNGSKSALPLALNFIASALGAGILFSYPEMAT
VTGVQGVVVYAAATALPLLAFGAIGPVIRRRCPTGFVLTEWTRQRYGQGTMLYLSLLTLATLFLYMVAELSALGQ
VVEALTGTGKLGVMVAECVVTTVYTSLGGFQVSFFTDVIQGALVLALVLLSAISVGVRTNAVKPGLVSSSGLTSP
SLLGWQLLYVLPMAVTTNAFFVSSFWLRTFASRTDFDLRLGSCLAAVVVGCVLAAVGSAGLIAVWSGAWPGEPKR
EASLALFALLERLPVWVVCVVVVMVVCLSTAALDSLQSAMVSSASNDLFGNSLAPRYVRGMVFIVIVPVIVVALK
AVSILQVYLVSDLLSAATVPVLCLGLIDRMHWWRGFEVVAGGIGGILSVFLFGLVYHGNAVDGARLLILHRGLYA
DDWSVFGAFVAAPLGGLVVAFAALALRLAFLFLRAKQRGERFDALDGPCDAGRVPGRQVHVTSGNDRPDTVDVKA
GKFF
Coding >Ophio5|3769
ATGGGACAGCCGTCGGTTGTGGCGTCCAACGCCATCATCTACACGACGTACGCGGCCTTTCTTGTGCTGGGGACG
GCGGTCGGGTGGCGGATGAGAGGCCGGGCGCGGAGCACGGGAGAGCTGCTGTCGAGTAACGGGAGCAAATCCGCG
TTACCGCTGGCTCTCAACTTTATCGCCTCTGCGCTCGGAGCCGGCATCCTCTTCTCCTACCCTGAGATGGCGACG
GTGACAGGCGTCCAAGGCGTCGTCGTCTACGCCGCAGCGACGGCTCTCCCGCTGCTAGCCTTCGGGGCCATCGGG
CCGGTGATCCGAAGACGATGTCCGACGGGCTTCGTGCTGACGGAATGGACTCGGCAGCGGTACGGGCAGGGTACG
ATGCTCTACCTCAGTCTATTGACGCTGGCGACCTTGTTCCTGTACATGGTTGCCGAGTTGTCTGCCTTGGGACAG
GTGGTCGAGGCCTTGACGGGGACGGGCAAGTTGGGTGTTATGGTGGCTGAGTGTGTGGTCACGACGGTTTATACG
TCCCTCGGCGGCTTTCAAGTCTCCTTCTTTACCGACGTCATTCAGGGAGCCTTGGTGCTGGCTCTCGTCCTGCTT
TCGGCCATCAGCGTGGGCGTACGGACCAATGCCGTGAAGCCAGGACTGGTATCGTCATCCGGACTGACCTCACCA
TCACTCCTGGGCTGGCAGTTGCTCTACGTTCTTCCCATGGCCGTGACGACAAACGCCTTCTTCGTCTCGAGCTTC
TGGTTGAGGACGTTTGCGTCGCGAACCGACTTTGATCTCCGCCTCGGTTCTTGTCTGGCCGCCGTCGTCGTCGGC
TGCGTCCTCGCCGCCGTCGGATCCGCGGGCCTGATCGCGGTCTGGTCCGGTGCTTGGCCTGGCGAGCCGAAACGT
GAAGCGTCGTTGGCGCTGTTTGCCCTGCTCGAGAGGTTGCCTGTTTGGGTGGTCTGCGTCGTCGTCGTCATGGTC
GTGTGTCTGAGTACGGCGGCGCTGGATAGTCTACAGTCGGCCATGGTTTCGTCGGCTTCCAACGATCTCTTCGGC
AACAGCTTGGCTCCGCGATATGTCCGTGGAATGGTGTTTATTGTCATCGTTCCTGTCATTGTCGTCGCCCTCAAA
GCCGTCTCGATCCTGCAGGTTTACCTCGTCAGCGACTTACTTTCGGCCGCGACGGTGCCCGTCTTGTGTCTCGGC
CTCATCGATAGGATGCATTGGTGGCGAGGCTTCGAAGTGGTCGCCGGCGGAATCGGGGGCATCCTTTCCGTTTTT
CTCTTCGGCCTGGTCTATCACGGCAACGCTGTCGATGGCGCTCGCTTGTTGATTCTTCACCGTGGTCTTTACGCT
GATGATTGGAGCGTCTTTGGCGCTTTCGTCGCTGCTCCGCTTGGTGGTCTTGTCGTCGCTTTCGCTGCCCTCGCC
TTGCGCTTGGCCTTTCTCTTCCTCCGGGCCAAGCAGAGAGGTGAACGTTTCGATGCTCTTGATGGCCCCTGCGAT
GCCGGAAGAGTGCCTGGTCGCCAGGTCCATGTCACTTCTGGAAATGACCGTCCGGATACTGTCGATGTCAAGGCC
GGCAAGTTTTTC
Transcript >Ophio5|3769
ATGGGACAGCCGTCGGTTGTGGCGTCCAACGCCATCATCTACACGACGTACGCGGCCTTTCTTGTGCTGGGGACG
GCGGTCGGGTGGCGGATGAGAGGCCGGGCGCGGAGCACGGGAGAGCTGCTGTCGAGTAACGGGAGCAAATCCGCG
TTACCGCTGGCTCTCAACTTTATCGCCTCTGCGCTCGGAGCCGGCATCCTCTTCTCCTACCCTGAGATGGCGACG
GTGACAGGCGTCCAAGGCGTCGTCGTCTACGCCGCAGCGACGGCTCTCCCGCTGCTAGCCTTCGGGGCCATCGGG
CCGGTGATCCGAAGACGATGTCCGACGGGCTTCGTGCTGACGGAATGGACTCGGCAGCGGTACGGGCAGGGTACG
ATGCTCTACCTCAGTCTATTGACGCTGGCGACCTTGTTCCTGTACATGGTTGCCGAGTTGTCTGCCTTGGGACAG
GTGGTCGAGGCCTTGACGGGGACGGGCAAGTTGGGTGTTATGGTGGCTGAGTGTGTGGTCACGACGGTTTATACG
TCCCTCGGCGGCTTTCAAGTCTCCTTCTTTACCGACGTCATTCAGGGAGCCTTGGTGCTGGCTCTCGTCCTGCTT
TCGGCCATCAGCGTGGGCGTACGGACCAATGCCGTGAAGCCAGGACTGGTATCGTCATCCGGACTGACCTCACCA
TCACTCCTGGGCTGGCAGTTGCTCTACGTTCTTCCCATGGCCGTGACGACAAACGCCTTCTTCGTCTCGAGCTTC
TGGTTGAGGACGTTTGCGTCGCGAACCGACTTTGATCTCCGCCTCGGTTCTTGTCTGGCCGCCGTCGTCGTCGGC
TGCGTCCTCGCCGCCGTCGGATCCGCGGGCCTGATCGCGGTCTGGTCCGGTGCTTGGCCTGGCGAGCCGAAACGT
GAAGCGTCGTTGGCGCTGTTTGCCCTGCTCGAGAGGTTGCCTGTTTGGGTGGTCTGCGTCGTCGTCGTCATGGTC
GTGTGTCTGAGTACGGCGGCGCTGGATAGTCTACAGTCGGCCATGGTTTCGTCGGCTTCCAACGATCTCTTCGGC
AACAGCTTGGCTCCGCGATATGTCCGTGGAATGGTGTTTATTGTCATCGTTCCTGTCATTGTCGTCGCCCTCAAA
GCCGTCTCGATCCTGCAGGTTTACCTCGTCAGCGACTTACTTTCGGCCGCGACGGTGCCCGTCTTGTGTCTCGGC
CTCATCGATAGGATGCATTGGTGGCGAGGCTTCGAAGTGGTCGCCGGCGGAATCGGGGGCATCCTTTCCGTTTTT
CTCTTCGGCCTGGTCTATCACGGCAACGCTGTCGATGGCGCTCGCTTGTTGATTCTTCACCGTGGTCTTTACGCT
GATGATTGGAGCGTCTTTGGCGCTTTCGTCGCTGCTCCGCTTGGTGGTCTTGTCGTCGCTTTCGCTGCCCTCGCC
TTGCGCTTGGCCTTTCTCTTCCTCCGGGCCAAGCAGAGAGGTGAACGTTTCGATGCTCTTGATGGCCCCTGCGAT
GCCGGAAGAGTGCCTGGTCGCCAGGTCCATGTCACTTCTGGAAATGACCGTCCGGATACTGTCGATGTCAAGGCC
GGCAAGTTTTTCTGA
Gene >Ophio5|3769
ATGGGACAGCCGTCGGTTGTGGCGTCCAACGCCATCATCTACACGACGTACGCGGCCTTTCTGTGAGTAGCGCCG
CATTCTGTCTCCCGTCTCCTGTTTCTTTGCGTGACTGACGATGGAAAAAAAAAATTAAATTAAATAAAAGTGTGC
TGGGGACGGCGGTCGGGTGGCGGATGAGAGGCCGGGCGCGGAGCACGGGAGAGCTGCTGTCGAGTAACGGGAGCA
AATCCGGTTGGTGACCGGAGTGGTGAAGATGAGTAAGAGAGATTATGGCTGACTGGGGTTTGGGGTGGATGAACA
GCGTTACCGCTGGCTCTCAACTTTATCGCCTCTGCGCTCGGAGCCGGCATCCTCTTCTCCTACCCTGAGATGGCG
ACGGTGACAGGCGTCCAAGGCGTCGTCGTCTACGCCGCAGCGACGGCTCTCCCGCTGCTAGCCTTCGGGGCCATC
GGGCCGGTGATCCGAAGACGATGTCCGACGGGCTTCGTGCTGACGGAATGGACTCGGCAGCGGTACGGGCAGGGT
ACGATGCTCTACCTCAGTCTATTGACGCTGGCGACCTTGTTCCTGTACATGGTTGCCGAGTTGTCTGCCTTGGGA
CAGGTGGTCGAGGCCTTGACGGGGACGGGCAAGTTGGGTGTTATGGTGGCTGAGTGTGTGGTCACGACGGTTTAT
ACGTGTGAGTTGTCACCACCCTTTACTTTGGCGTTTTGTCTGTCTCTCTCTCTCTCTCTCTCTCTCCTCTCCCCC
CTTTTCCACAAACGGTTCTTCTCAGAGAGAGAGAGACAACACAAAAGACTGACCTCGGTAACCCCCCTCAGAAGC
CCTCGGCGGCTTTCAAGTCTCCTTCTTTACCGACGTCATTCAGGGAGCCTTGGTGCTGGCTCTCGTCCTGCTTTC
GGCCATCAGCGTGGGCGTACGGACCAATGCCGTGAAGCCAGGACTGGTATCGTCATCCGGACTGACCTCACCATC
ACTCCTGGGCTGGCAGTTGCTCTACGTTCTTCCCATGGCCGTGACGACAAACGCCTTCTTCGTCTCGAGCTTCTG
GTTGAGGACGTTTGCGTCGCGAACCGACTTTGATCTCCGCCTCGGTTCTTGTCTGGCCGCCGTCGTCGTCGGCTG
CGTCCTCGCCGCCGTCGGATCCGCGGGCCTGATCGCGGTCTGGTCCGGTGCTTGGCCTGGCGAGCCGAAACGTGA
AGCGTCGTTGGCGCTGTTTGCCCTGCTCGAGAGGTTGCCTGTTTGGGTGGTCTGCGTCGTCGTCGTCATGGTCGT
GTGTCTGAGTACGGCGGCGCTGGATAGTCTACAGTCGGCCATGGTTTCGTCGGCTTCCAACGATCTCTTCGGCAA
CAGCTTGGCTCCGCGATATGTCCGTGGAATGGTGTTTATTGTCATCGTTCCTGTCATTGTCGTCGCCCTCAAAGC
CGTCTCGATCCTGCAGGTTTACCTCGTCAGCGACTTACTTTCGGCCGCGACGGTGCCCGTCTTGTGTCTCGGCCT
CATCGATAGGATGCATTGGTGGCGAGGCTTCGAAGTGGTCGCCGGCGGAATCGGGGGCATCCTTTCCGTTTTTCT
CTTCGGCCTGGTCTATCACGGCAACGCTGTCGATGGCGCTCGCTTGTTGATTCTTCACCGTGGTCTTTACGCTGA
TGATTGGAGCGTCTTTGGCGCTTTCGTCGCTGCTCCGCTTGGTGGTCTTGTCGTCGCTTTCGCTGCCCTCGCCTT
GCGCTTGGCCTTTCTCTTCCTCCGGGCCAAGCAGAGAGGTGAACGTTTCGATGCTCTTGATGGCCCCTGCGATGC
CGGAAGAGTGCCTGGTCGCCAGGTCCATGTCACTTCTGGAAATGACCGTCCGGATACTGTCGATGTCAAGGCCGG
CAAGTTTTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail