Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3769
Gene name
Locationscaffold_297:20298..22186
Strand+
Gene length (bp)1888
Transcript length (bp)1590
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P83740|SC5A6_DROME Putative sodium-dependent multivitamin transporter OS=Drosophila melanogaster GN=CG32669 PE=2 SV=1 14 213 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 10 29 19
2 49 71 22
3 81 103 22
4 124 143 19
5 163 185 22
6 192 209 17
7 229 251 22
8 272 294 22
9 314 336 22
10 357 374 17
11 379 401 22
12 413 435 22
13 459 481 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3769
MGQPSVVASNAIIYTTYAAFLVLGTAVGWRMRGRARSTGELLSSNGSKSALPLALNFIASALGAGILFSYPEMAT
VTGVQGVVVYAAATALPLLAFGAIGPVIRRRCPTGFVLTEWTRQRYGQGTMLYLSLLTLATLFLYMVAELSALGQ
VVEALTGTGKLGVMVAECVVTTVYTSLGGFQVSFFTDVIQGALVLALVLLSAISVGVRTNAVKPGLVSSSGLTSP
SLLGWQLLYVLPMAVTTNAFFVSSFWLRTFASRTDFDLRLGSCLAAVVVGCVLAAVGSAGLIAVWSGAWPGEPKR
EASLALFALLERLPVWVVCVVVVMVVCLSTAALDSLQSAMVSSASNDLFGNSLAPRYVRGMVFIVIVPVIVVALK
AVSILQVYLVSDLLSAATVPVLCLGLIDRMHWWRGFEVVAGGIGGILSVFLFGLVYHGNAVDGARLLILHRGLYA
DDWSVFGAFVAAPLGGLVVAFAALALRLAFLFLRAKQRGERFDALDGPCDAGRVPGRQVHVTSGNDRPDTVDVKA
GKFF
Coding >Ophio5|3769
ATGGGACAGCCGTCGGTTGTGGCGTCCAACGCCATCATCTACACGACGTACGCGGCCTTTCTTGTGCTGGGGACG
GCGGTCGGGTGGCGGATGAGAGGCCGGGCGCGGAGCACGGGAGAGCTGCTGTCGAGTAACGGGAGCAAATCCGCG
TTACCGCTGGCTCTCAACTTTATCGCCTCTGCGCTCGGAGCCGGCATCCTCTTCTCCTACCCTGAGATGGCGACG
GTGACAGGCGTCCAAGGCGTCGTCGTCTACGCCGCAGCGACGGCTCTCCCGCTGCTAGCCTTCGGGGCCATCGGG
CCGGTGATCCGAAGACGATGTCCGACGGGCTTCGTGCTGACGGAATGGACTCGGCAGCGGTACGGGCAGGGTACG
ATGCTCTACCTCAGTCTATTGACGCTGGCGACCTTGTTCCTGTACATGGTTGCCGAGTTGTCTGCCTTGGGACAG
GTGGTCGAGGCCTTGACGGGGACGGGCAAGTTGGGTGTTATGGTGGCTGAGTGTGTGGTCACGACGGTTTATACG
TCCCTCGGCGGCTTTCAAGTCTCCTTCTTTACCGACGTCATTCAGGGAGCCTTGGTGCTGGCTCTCGTCCTGCTT
TCGGCCATCAGCGTGGGCGTACGGACCAATGCCGTGAAGCCAGGACTGGTATCGTCATCCGGACTGACCTCACCA
TCACTCCTGGGCTGGCAGTTGCTCTACGTTCTTCCCATGGCCGTGACGACAAACGCCTTCTTCGTCTCGAGCTTC
TGGTTGAGGACGTTTGCGTCGCGAACCGACTTTGATCTCCGCCTCGGTTCTTGTCTGGCCGCCGTCGTCGTCGGC
TGCGTCCTCGCCGCCGTCGGATCCGCGGGCCTGATCGCGGTCTGGTCCGGTGCTTGGCCTGGCGAGCCGAAACGT
GAAGCGTCGTTGGCGCTGTTTGCCCTGCTCGAGAGGTTGCCTGTTTGGGTGGTCTGCGTCGTCGTCGTCATGGTC
GTGTGTCTGAGTACGGCGGCGCTGGATAGTCTACAGTCGGCCATGGTTTCGTCGGCTTCCAACGATCTCTTCGGC
AACAGCTTGGCTCCGCGATATGTCCGTGGAATGGTGTTTATTGTCATCGTTCCTGTCATTGTCGTCGCCCTCAAA
GCCGTCTCGATCCTGCAGGTTTACCTCGTCAGCGACTTACTTTCGGCCGCGACGGTGCCCGTCTTGTGTCTCGGC
CTCATCGATAGGATGCATTGGTGGCGAGGCTTCGAAGTGGTCGCCGGCGGAATCGGGGGCATCCTTTCCGTTTTT
CTCTTCGGCCTGGTCTATCACGGCAACGCTGTCGATGGCGCTCGCTTGTTGATTCTTCACCGTGGTCTTTACGCT
GATGATTGGAGCGTCTTTGGCGCTTTCGTCGCTGCTCCGCTTGGTGGTCTTGTCGTCGCTTTCGCTGCCCTCGCC
TTGCGCTTGGCCTTTCTCTTCCTCCGGGCCAAGCAGAGAGGTGAACGTTTCGATGCTCTTGATGGCCCCTGCGAT
GCCGGAAGAGTGCCTGGTCGCCAGGTCCATGTCACTTCTGGAAATGACCGTCCGGATACTGTCGATGTCAAGGCC
GGCAAGTTTTTC
Transcript >Ophio5|3769
ATGGGACAGCCGTCGGTTGTGGCGTCCAACGCCATCATCTACACGACGTACGCGGCCTTTCTTGTGCTGGGGACG
GCGGTCGGGTGGCGGATGAGAGGCCGGGCGCGGAGCACGGGAGAGCTGCTGTCGAGTAACGGGAGCAAATCCGCG
TTACCGCTGGCTCTCAACTTTATCGCCTCTGCGCTCGGAGCCGGCATCCTCTTCTCCTACCCTGAGATGGCGACG
GTGACAGGCGTCCAAGGCGTCGTCGTCTACGCCGCAGCGACGGCTCTCCCGCTGCTAGCCTTCGGGGCCATCGGG
CCGGTGATCCGAAGACGATGTCCGACGGGCTTCGTGCTGACGGAATGGACTCGGCAGCGGTACGGGCAGGGTACG
ATGCTCTACCTCAGTCTATTGACGCTGGCGACCTTGTTCCTGTACATGGTTGCCGAGTTGTCTGCCTTGGGACAG
GTGGTCGAGGCCTTGACGGGGACGGGCAAGTTGGGTGTTATGGTGGCTGAGTGTGTGGTCACGACGGTTTATACG
TCCCTCGGCGGCTTTCAAGTCTCCTTCTTTACCGACGTCATTCAGGGAGCCTTGGTGCTGGCTCTCGTCCTGCTT
TCGGCCATCAGCGTGGGCGTACGGACCAATGCCGTGAAGCCAGGACTGGTATCGTCATCCGGACTGACCTCACCA
TCACTCCTGGGCTGGCAGTTGCTCTACGTTCTTCCCATGGCCGTGACGACAAACGCCTTCTTCGTCTCGAGCTTC
TGGTTGAGGACGTTTGCGTCGCGAACCGACTTTGATCTCCGCCTCGGTTCTTGTCTGGCCGCCGTCGTCGTCGGC
TGCGTCCTCGCCGCCGTCGGATCCGCGGGCCTGATCGCGGTCTGGTCCGGTGCTTGGCCTGGCGAGCCGAAACGT
GAAGCGTCGTTGGCGCTGTTTGCCCTGCTCGAGAGGTTGCCTGTTTGGGTGGTCTGCGTCGTCGTCGTCATGGTC
GTGTGTCTGAGTACGGCGGCGCTGGATAGTCTACAGTCGGCCATGGTTTCGTCGGCTTCCAACGATCTCTTCGGC
AACAGCTTGGCTCCGCGATATGTCCGTGGAATGGTGTTTATTGTCATCGTTCCTGTCATTGTCGTCGCCCTCAAA
GCCGTCTCGATCCTGCAGGTTTACCTCGTCAGCGACTTACTTTCGGCCGCGACGGTGCCCGTCTTGTGTCTCGGC
CTCATCGATAGGATGCATTGGTGGCGAGGCTTCGAAGTGGTCGCCGGCGGAATCGGGGGCATCCTTTCCGTTTTT
CTCTTCGGCCTGGTCTATCACGGCAACGCTGTCGATGGCGCTCGCTTGTTGATTCTTCACCGTGGTCTTTACGCT
GATGATTGGAGCGTCTTTGGCGCTTTCGTCGCTGCTCCGCTTGGTGGTCTTGTCGTCGCTTTCGCTGCCCTCGCC
TTGCGCTTGGCCTTTCTCTTCCTCCGGGCCAAGCAGAGAGGTGAACGTTTCGATGCTCTTGATGGCCCCTGCGAT
GCCGGAAGAGTGCCTGGTCGCCAGGTCCATGTCACTTCTGGAAATGACCGTCCGGATACTGTCGATGTCAAGGCC
GGCAAGTTTTTCTGA
Gene >Ophio5|3769
ATGGGACAGCCGTCGGTTGTGGCGTCCAACGCCATCATCTACACGACGTACGCGGCCTTTCTGTGAGTAGCGCCG
CATTCTGTCTCCCGTCTCCTGTTTCTTTGCGTGACTGACGATGGAAAAAAAAAATTAAATTAAATAAAAGTGTGC
TGGGGACGGCGGTCGGGTGGCGGATGAGAGGCCGGGCGCGGAGCACGGGAGAGCTGCTGTCGAGTAACGGGAGCA
AATCCGGTTGGTGACCGGAGTGGTGAAGATGAGTAAGAGAGATTATGGCTGACTGGGGTTTGGGGTGGATGAACA
GCGTTACCGCTGGCTCTCAACTTTATCGCCTCTGCGCTCGGAGCCGGCATCCTCTTCTCCTACCCTGAGATGGCG
ACGGTGACAGGCGTCCAAGGCGTCGTCGTCTACGCCGCAGCGACGGCTCTCCCGCTGCTAGCCTTCGGGGCCATC
GGGCCGGTGATCCGAAGACGATGTCCGACGGGCTTCGTGCTGACGGAATGGACTCGGCAGCGGTACGGGCAGGGT
ACGATGCTCTACCTCAGTCTATTGACGCTGGCGACCTTGTTCCTGTACATGGTTGCCGAGTTGTCTGCCTTGGGA
CAGGTGGTCGAGGCCTTGACGGGGACGGGCAAGTTGGGTGTTATGGTGGCTGAGTGTGTGGTCACGACGGTTTAT
ACGTGTGAGTTGTCACCACCCTTTACTTTGGCGTTTTGTCTGTCTCTCTCTCTCTCTCTCTCTCTCCTCTCCCCC
CTTTTCCACAAACGGTTCTTCTCAGAGAGAGAGAGACAACACAAAAGACTGACCTCGGTAACCCCCCTCAGAAGC
CCTCGGCGGCTTTCAAGTCTCCTTCTTTACCGACGTCATTCAGGGAGCCTTGGTGCTGGCTCTCGTCCTGCTTTC
GGCCATCAGCGTGGGCGTACGGACCAATGCCGTGAAGCCAGGACTGGTATCGTCATCCGGACTGACCTCACCATC
ACTCCTGGGCTGGCAGTTGCTCTACGTTCTTCCCATGGCCGTGACGACAAACGCCTTCTTCGTCTCGAGCTTCTG
GTTGAGGACGTTTGCGTCGCGAACCGACTTTGATCTCCGCCTCGGTTCTTGTCTGGCCGCCGTCGTCGTCGGCTG
CGTCCTCGCCGCCGTCGGATCCGCGGGCCTGATCGCGGTCTGGTCCGGTGCTTGGCCTGGCGAGCCGAAACGTGA
AGCGTCGTTGGCGCTGTTTGCCCTGCTCGAGAGGTTGCCTGTTTGGGTGGTCTGCGTCGTCGTCGTCATGGTCGT
GTGTCTGAGTACGGCGGCGCTGGATAGTCTACAGTCGGCCATGGTTTCGTCGGCTTCCAACGATCTCTTCGGCAA
CAGCTTGGCTCCGCGATATGTCCGTGGAATGGTGTTTATTGTCATCGTTCCTGTCATTGTCGTCGCCCTCAAAGC
CGTCTCGATCCTGCAGGTTTACCTCGTCAGCGACTTACTTTCGGCCGCGACGGTGCCCGTCTTGTGTCTCGGCCT
CATCGATAGGATGCATTGGTGGCGAGGCTTCGAAGTGGTCGCCGGCGGAATCGGGGGCATCCTTTCCGTTTTTCT
CTTCGGCCTGGTCTATCACGGCAACGCTGTCGATGGCGCTCGCTTGTTGATTCTTCACCGTGGTCTTTACGCTGA
TGATTGGAGCGTCTTTGGCGCTTTCGTCGCTGCTCCGCTTGGTGGTCTTGTCGTCGCTTTCGCTGCCCTCGCCTT
GCGCTTGGCCTTTCTCTTCCTCCGGGCCAAGCAGAGAGGTGAACGTTTCGATGCTCTTGATGGCCCCTGCGATGC
CGGAAGAGTGCCTGGTCGCCAGGTCCATGTCACTTCTGGAAATGACCGTCCGGATACTGTCGATGTCAAGGCCGG
CAAGTTTTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail