Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3765
Gene name
Locationscaffold_297:9600..12090
Strand+
Gene length (bp)2490
Transcript length (bp)2373
Coding sequence length (bp)2370
Protein length (aa) 790

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12862 ANAPC5 Anaphase-promoting complex subunit 5 7.9E-33 286 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4W7|APC5_SCHPO Anaphase-promoting complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc5 PE=1 SV=3 4 770 3.0E-49
sp|Q08683|APC5_YEAST Anaphase-promoting complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC5 PE=1 SV=1 288 636 1.0E-12
sp|Q5ZKK3|APC5_CHICK Anaphase-promoting complex subunit 5 OS=Gallus gallus GN=ANAPC5 PE=2 SV=1 137 369 3.0E-08
sp|Q5RE52|APC5_PONAB Anaphase-promoting complex subunit 5 OS=Pongo abelii GN=ANAPC5 PE=2 SV=1 137 374 1.0E-07
sp|Q9UJX4|APC5_HUMAN Anaphase-promoting complex subunit 5 OS=Homo sapiens GN=ANAPC5 PE=1 SV=2 137 374 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4W7|APC5_SCHPO Anaphase-promoting complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc5 PE=1 SV=3 4 770 3.0E-49
sp|Q08683|APC5_YEAST Anaphase-promoting complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC5 PE=1 SV=1 288 636 1.0E-12
sp|Q5ZKK3|APC5_CHICK Anaphase-promoting complex subunit 5 OS=Gallus gallus GN=ANAPC5 PE=2 SV=1 137 369 3.0E-08
sp|Q5RE52|APC5_PONAB Anaphase-promoting complex subunit 5 OS=Pongo abelii GN=ANAPC5 PE=2 SV=1 137 374 1.0E-07
sp|Q9UJX4|APC5_HUMAN Anaphase-promoting complex subunit 5 OS=Homo sapiens GN=ANAPC5 PE=1 SV=2 137 374 1.0E-07
sp|Q8BTZ4|APC5_MOUSE Anaphase-promoting complex subunit 5 OS=Mus musculus GN=Anapc5 PE=1 SV=1 137 374 5.0E-07
sp|A1L1K3|APC5_RAT Anaphase-promoting complex subunit 5 OS=Rattus norvegicus GN=Anapc5 PE=2 SV=1 137 374 8.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5352 0.6321 0.0818 0.0562 0.0629 0.0023 0.1909 0.285 0.2811 0.0098

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1947
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7281
Ophiocordyceps australis map64 (Brazil) OphauB2|5071
Ophiocordyceps camponoti-floridani Ophcf2|06139
Ophiocordyceps camponoti-rufipedis Ophun1|4425
Ophiocordyceps kimflemingae Ophio5|3765 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2090

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3765
MARYLNPAKIGLLALIELYTEEAVPSEAVLPVLSFITSHILDHSHNASQEARWSKAERTVSLVVTIKDFEKLLSG
YPVLTGMPGRKLWDQFLTKLWDINSLDALHAFFEATPALLTKARDEEEEEEEEEEEEKEDEDGESGGKIKLSRNS
PFGAFVRRARLEFQRLAFHDCTELWKDFVRYRQPTVSYLRRKNLSLGRLGFDNVLLLGGQDEWDPDGIAALAAVA
YGDMLSGDESGTMAVSTDDIEILVEFQISRMQKFGNRVPVEIRLQFEDLLRDSFLVPSVTHYLSFLDAWRASDYT
TAFDYLHRYFDYTMQYRDRLFYQYALMNLAVLQADFGCYREAVSAMLETVSTARENRDMTCLNFALNWLFHFGRA
HPNLVQDLESHSMLGAGKESLAFLRVKAKESGMWTLWSSVLLAESKMALVNGDSVATSLEHLVRSSQIIVDKNLK
NMFGSQLSLQAALWSRLGLAHLSVCASETFLRCHARNSVFDDELKHTCRIAFALAERGKYDEALRRLDGLDENSL
RSWKPSQYWLKYRAIIKLKCDLHHNNLDAARRLLDQLLQSKTDDLEPDMAFVVDSLHVDYLSRRGDLQAAFAEVD
SLTVRLRDDSRDVAIGVKLLLLKVALLDRCGRPLRAFSAAVRATNMAWRARLLPSLWEAVGALSAMLVSLGEFDA
AVQLLTAVVPRTLECDAAAPAAHLYSVLADAHMGLAGGMEPRSSRRTECLTRALRAVQKALDHYSAVEDVERQCE
TMAKKAMIMKLTGEAALAADYAAAYVELRKRAEALSLDGA
Coding >Ophio5|3765
ATGGCTCGTTATCTCAACCCTGCCAAAATTGGCCTGCTGGCTCTCATCGAACTCTATACAGAAGAGGCGGTGCCG
AGCGAGGCGGTGCTACCGGTTCTGTCCTTCATCACCTCGCATATCCTCGATCACAGCCATAATGCCTCGCAAGAA
GCGCGGTGGAGCAAGGCAGAGCGCACAGTCAGCCTCGTCGTCACCATCAAGGACTTTGAGAAGCTGCTGAGCGGC
TATCCCGTCCTTACGGGCATGCCAGGGAGGAAGCTGTGGGACCAGTTTCTCACTAAGCTTTGGGATATCAACTCT
CTCGACGCGCTGCACGCCTTCTTCGAGGCCACCCCGGCTCTGCTGACGAAAGCGAGAGACGAGGAGGAGGAAGAG
GAGGAAGAGGAGGAGGAGGAGAAAGAGGACGAAGACGGCGAGTCAGGCGGAAAGATTAAACTTTCTCGGAACTCG
CCGTTTGGCGCCTTCGTGCGCAGAGCGCGCCTCGAGTTCCAGCGGCTGGCCTTTCACGACTGCACCGAGCTGTGG
AAGGACTTTGTGCGATATCGACAACCAACCGTGTCCTACTTGCGGCGCAAGAATCTCTCTCTGGGGCGTCTGGGC
TTCGACAACGTGTTGCTACTCGGGGGTCAGGATGAATGGGATCCAGACGGCATAGCCGCGCTGGCTGCCGTCGCT
TACGGGGATATGCTCAGTGGCGACGAGAGCGGGACCATGGCTGTGAGCACCGACGACATTGAGATTCTCGTCGAG
TTTCAAATCAGCCGGATGCAAAAATTCGGCAACAGAGTGCCTGTCGAGATTCGACTTCAGTTTGAGGACCTGCTC
CGCGATAGCTTCCTCGTGCCGAGCGTCACCCATTATCTCAGCTTCCTCGACGCCTGGAGAGCGAGCGACTACACG
ACAGCCTTTGACTACCTCCACCGATACTTTGACTACACGATGCAGTACCGCGACCGGCTCTTCTATCAGTATGCC
CTCATGAACCTGGCCGTCCTCCAAGCCGACTTTGGCTGCTACCGCGAGGCCGTGTCGGCCATGCTCGAGACGGTC
TCGACGGCGCGGGAAAACCGCGACATGACGTGCCTCAACTTTGCCCTCAACTGGCTCTTCCACTTCGGCCGCGCC
CACCCAAATCTCGTGCAAGACCTCGAGTCGCACAGCATGCTGGGCGCGGGAAAGGAGAGCCTGGCCTTTCTACGC
GTCAAGGCCAAAGAATCGGGCATGTGGACGCTCTGGAGCTCGGTGCTACTGGCCGAGTCCAAGATGGCCCTCGTC
AACGGCGACTCGGTGGCGACGTCGCTCGAGCATCTGGTTCGCAGCTCGCAGATCATCGTCGACAAGAACCTCAAG
AACATGTTTGGCTCGCAGCTCTCCCTCCAAGCGGCGTTATGGAGTCGGCTCGGCCTAGCTCATCTATCGGTCTGC
GCATCCGAGACCTTTCTGCGATGTCACGCGCGAAACTCGGTCTTTGACGACGAGCTCAAGCACACGTGCCGGATC
GCCTTTGCTCTCGCCGAGCGGGGCAAGTATGACGAAGCCTTGCGTCGGCTCGACGGCCTCGACGAGAACTCGCTC
CGGTCGTGGAAGCCCAGTCAATACTGGCTCAAATATCGTGCCATCATCAAGCTCAAGTGCGACCTCCATCACAAC
AATCTCGACGCCGCCCGCCGTCTCCTCGACCAACTGCTGCAGTCCAAGACAGACGACCTTGAGCCGGACATGGCC
TTTGTCGTCGACTCGCTGCACGTCGACTATCTTTCGCGCCGGGGCGATCTGCAGGCTGCCTTTGCCGAGGTCGAT
TCCCTGACGGTCCGGTTACGCGACGACAGCCGCGACGTAGCCATCGGCGTCAAGCTTCTCCTTCTCAAGGTCGCC
CTGCTGGACCGCTGTGGACGACCGCTACGGGCCTTTTCCGCTGCCGTGCGCGCCACAAACATGGCCTGGCGGGCG
CGTCTCCTCCCCTCTCTATGGGAGGCCGTCGGCGCGCTATCGGCGATGCTGGTGTCGCTGGGCGAGTTCGACGCG
GCCGTTCAGCTGCTCACCGCAGTTGTGCCGCGTACGCTCGAGTGTGACGCCGCGGCGCCGGCAGCGCACCTCTAC
TCAGTCCTCGCCGACGCACACATGGGCCTCGCTGGTGGCATGGAGCCCAGGTCGAGCCGGCGTACCGAGTGTCTG
ACCAGGGCGCTGAGGGCGGTGCAGAAGGCCCTGGACCACTACTCCGCTGTCGAGGACGTGGAGCGCCAGTGCGAG
ACGATGGCCAAGAAGGCCATGATTATGAAGCTTACGGGTGAGGCCGCCCTGGCAGCAGACTATGCTGCGGCCTAC
GTCGAGCTGCGTAAGAGGGCCGAGGCGCTGAGCCTGGACGGGGCG
Transcript >Ophio5|3765
ATGGCTCGTTATCTCAACCCTGCCAAAATTGGCCTGCTGGCTCTCATCGAACTCTATACAGAAGAGGCGGTGCCG
AGCGAGGCGGTGCTACCGGTTCTGTCCTTCATCACCTCGCATATCCTCGATCACAGCCATAATGCCTCGCAAGAA
GCGCGGTGGAGCAAGGCAGAGCGCACAGTCAGCCTCGTCGTCACCATCAAGGACTTTGAGAAGCTGCTGAGCGGC
TATCCCGTCCTTACGGGCATGCCAGGGAGGAAGCTGTGGGACCAGTTTCTCACTAAGCTTTGGGATATCAACTCT
CTCGACGCGCTGCACGCCTTCTTCGAGGCCACCCCGGCTCTGCTGACGAAAGCGAGAGACGAGGAGGAGGAAGAG
GAGGAAGAGGAGGAGGAGGAGAAAGAGGACGAAGACGGCGAGTCAGGCGGAAAGATTAAACTTTCTCGGAACTCG
CCGTTTGGCGCCTTCGTGCGCAGAGCGCGCCTCGAGTTCCAGCGGCTGGCCTTTCACGACTGCACCGAGCTGTGG
AAGGACTTTGTGCGATATCGACAACCAACCGTGTCCTACTTGCGGCGCAAGAATCTCTCTCTGGGGCGTCTGGGC
TTCGACAACGTGTTGCTACTCGGGGGTCAGGATGAATGGGATCCAGACGGCATAGCCGCGCTGGCTGCCGTCGCT
TACGGGGATATGCTCAGTGGCGACGAGAGCGGGACCATGGCTGTGAGCACCGACGACATTGAGATTCTCGTCGAG
TTTCAAATCAGCCGGATGCAAAAATTCGGCAACAGAGTGCCTGTCGAGATTCGACTTCAGTTTGAGGACCTGCTC
CGCGATAGCTTCCTCGTGCCGAGCGTCACCCATTATCTCAGCTTCCTCGACGCCTGGAGAGCGAGCGACTACACG
ACAGCCTTTGACTACCTCCACCGATACTTTGACTACACGATGCAGTACCGCGACCGGCTCTTCTATCAGTATGCC
CTCATGAACCTGGCCGTCCTCCAAGCCGACTTTGGCTGCTACCGCGAGGCCGTGTCGGCCATGCTCGAGACGGTC
TCGACGGCGCGGGAAAACCGCGACATGACGTGCCTCAACTTTGCCCTCAACTGGCTCTTCCACTTCGGCCGCGCC
CACCCAAATCTCGTGCAAGACCTCGAGTCGCACAGCATGCTGGGCGCGGGAAAGGAGAGCCTGGCCTTTCTACGC
GTCAAGGCCAAAGAATCGGGCATGTGGACGCTCTGGAGCTCGGTGCTACTGGCCGAGTCCAAGATGGCCCTCGTC
AACGGCGACTCGGTGGCGACGTCGCTCGAGCATCTGGTTCGCAGCTCGCAGATCATCGTCGACAAGAACCTCAAG
AACATGTTTGGCTCGCAGCTCTCCCTCCAAGCGGCGTTATGGAGTCGGCTCGGCCTAGCTCATCTATCGGTCTGC
GCATCCGAGACCTTTCTGCGATGTCACGCGCGAAACTCGGTCTTTGACGACGAGCTCAAGCACACGTGCCGGATC
GCCTTTGCTCTCGCCGAGCGGGGCAAGTATGACGAAGCCTTGCGTCGGCTCGACGGCCTCGACGAGAACTCGCTC
CGGTCGTGGAAGCCCAGTCAATACTGGCTCAAATATCGTGCCATCATCAAGCTCAAGTGCGACCTCCATCACAAC
AATCTCGACGCCGCCCGCCGTCTCCTCGACCAACTGCTGCAGTCCAAGACAGACGACCTTGAGCCGGACATGGCC
TTTGTCGTCGACTCGCTGCACGTCGACTATCTTTCGCGCCGGGGCGATCTGCAGGCTGCCTTTGCCGAGGTCGAT
TCCCTGACGGTCCGGTTACGCGACGACAGCCGCGACGTAGCCATCGGCGTCAAGCTTCTCCTTCTCAAGGTCGCC
CTGCTGGACCGCTGTGGACGACCGCTACGGGCCTTTTCCGCTGCCGTGCGCGCCACAAACATGGCCTGGCGGGCG
CGTCTCCTCCCCTCTCTATGGGAGGCCGTCGGCGCGCTATCGGCGATGCTGGTGTCGCTGGGCGAGTTCGACGCG
GCCGTTCAGCTGCTCACCGCAGTTGTGCCGCGTACGCTCGAGTGTGACGCCGCGGCGCCGGCAGCGCACCTCTAC
TCAGTCCTCGCCGACGCACACATGGGCCTCGCTGGTGGCATGGAGCCCAGGTCGAGCCGGCGTACCGAGTGTCTG
ACCAGGGCGCTGAGGGCGGTGCAGAAGGCCCTGGACCACTACTCCGCTGTCGAGGACGTGGAGCGCCAGTGCGAG
ACGATGGCCAAGAAGGCCATGATTATGAAGCTTACGGGTGAGGCCGCCCTGGCAGCAGACTATGCTGCGGCCTAC
GTCGAGCTGCGTAAGAGGGCCGAGGCGCTGAGCCTGGACGGGGCGTGA
Gene >Ophio5|3765
ATGGCTCGTTATCTCAACCCTGCCAAAATTGGCCTGCTGGCTCTCATCGAACTCTATACAGAAGAGGCGGTGCCG
AGCGAGGCGGTGCTACCGGTTCTGTCCTTCATCACCTCGCATATCCTCGATCACAGCCATAATGCCTCGCAAGAA
GCGCGGTGGAGCAAGGCAGAGCGCACAGTCAGCCTCGTCGTCACCATCAAGGACTTTGAGAAGCTGCTGAGCGGC
TATCCCGTCCTTACGGGCATGCCAGGGAGGAAGCTGTGGGACCAGTTTCTCACTAAGCTTTGGGATATCAACTCT
CTCGACGCGCTGCACGCCTTCTTCGAGGCCACCCCGGCTCTGCTGACGAAAGCGAGAGACGAGGAGGAGGAAGAG
GAGGAAGAGGAGGAGGAGGAGAAAGAGGACGAAGACGGCGAGTCAGGCGGAAAGATTAAACTTTCTCGGAACTCG
CCGTTTGGCGCCTTCGTGCGCAGAGCGCGCCTCGAGTTCCAGCGGCTGGCCTTTCACGACTGCACCGAGCTGTGG
AAGGACTTTGTGCGATATCGACAACCAACCGTGTCCTACTTGCGGCGCAAGAATCTCTCTCTGGGGCGTCTGGGC
TTCGACAACGTGTTGCTACTCGGGGGTCAGGATGAATGGGATCCAGACGGCATAGCCGCGCTGGCTGCCGTCGCT
TACGGGGATATGCTCAGTGGCGACGAGAGCGGGACCATGGCTGTGAGCACCGACGACATTGAGATTCTCGTCGAG
TTTCAAATCAGCCGGATGCAAAGTGAGTGTTTCCGTGCTGCATCATATGCTGGAGAGTGCTGACCGTTGTATGTC
AAGAATTCGGCAACAGAGTGCCTGTCGAGATTCGACTTCAGTTTGAGGACCTGCTCCGCGATAGCTTCCTCGTGC
CGAGCGTCACCCATTATCTCAGGTCGCCACTCCTTGCTCGCCTCTGCTCTCTCGTTCGGTTTGCTGACATCCGAC
AACTACAGCTTCCTCGACGCCTGGAGAGCGAGCGACTACACGACAGCCTTTGACTACCTCCACCGATACTTTGAC
TACACGATGCAGTACCGCGACCGGCTCTTCTATCAGTATGCCCTCATGAACCTGGCCGTCCTCCAAGCCGACTTT
GGCTGCTACCGCGAGGCCGTGTCGGCCATGCTCGAGACGGTCTCGACGGCGCGGGAAAACCGCGACATGACGTGC
CTCAACTTTGCCCTCAACTGGCTCTTCCACTTCGGCCGCGCCCACCCAAATCTCGTGCAAGACCTCGAGTCGCAC
AGCATGCTGGGCGCGGGAAAGGAGAGCCTGGCCTTTCTACGCGTCAAGGCCAAAGAATCGGGCATGTGGACGCTC
TGGAGCTCGGTGCTACTGGCCGAGTCCAAGATGGCCCTCGTCAACGGCGACTCGGTGGCGACGTCGCTCGAGCAT
CTGGTTCGCAGCTCGCAGATCATCGTCGACAAGAACCTCAAGAACATGTTTGGCTCGCAGCTCTCCCTCCAAGCG
GCGTTATGGAGTCGGCTCGGCCTAGCTCATCTATCGGTCTGCGCATCCGAGACCTTTCTGCGATGTCACGCGCGA
AACTCGGTCTTTGACGACGAGCTCAAGCACACGTGCCGGATCGCCTTTGCTCTCGCCGAGCGGGGCAAGTATGAC
GAAGCCTTGCGTCGGCTCGACGGCCTCGACGAGAACTCGCTCCGGTCGTGGAAGCCCAGTCAATACTGGCTCAAA
TATCGTGCCATCATCAAGCTCAAGTGCGACCTCCATCACAACAATCTCGACGCCGCCCGCCGTCTCCTCGACCAA
CTGCTGCAGTCCAAGACAGACGACCTTGAGCCGGACATGGCCTTTGTCGTCGACTCGCTGCACGTCGACTATCTT
TCGCGCCGGGGCGATCTGCAGGCTGCCTTTGCCGAGGTCGATTCCCTGACGGTCCGGTTACGCGACGACAGCCGC
GACGTAGCCATCGGCGTCAAGCTTCTCCTTCTCAAGGTCGCCCTGCTGGACCGCTGTGGACGACCGCTACGGGCC
TTTTCCGCTGCCGTGCGCGCCACAAACATGGCCTGGCGGGCGCGTCTCCTCCCCTCTCTATGGGAGGCCGTCGGC
GCGCTATCGGCGATGCTGGTGTCGCTGGGCGAGTTCGACGCGGCCGTTCAGCTGCTCACCGCAGTTGTGCCGCGT
ACGCTCGAGTGTGACGCCGCGGCGCCGGCAGCGCACCTCTACTCAGTCCTCGCCGACGCACACATGGGCCTCGCT
GGTGGCATGGAGCCCAGGTCGAGCCGGCGTACCGAGTGTCTGACCAGGGCGCTGAGGGCGGTGCAGAAGGCCCTG
GACCACTACTCCGCTGTCGAGGACGTGGAGCGCCAGTGCGAGACGATGGCCAAGAAGGCCATGATTATGAAGCTT
ACGGGTGAGGCCGCCCTGGCAGCAGACTATGCTGCGGCCTACGTCGAGCTGCGTAAGAGGGCCGAGGCGCTGAGC
CTGGACGGGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail