Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3754
Gene name
Locationscaffold_296:15597..16293
Strand+
Gene length (bp)696
Transcript length (bp)555
Coding sequence length (bp)552
Protein length (aa) 184

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06417 DUF1077 Protein of unknown function (DUF1077) 1.6E-50 57 172

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94520|YQ13_SCHPO ER membrane protein complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1281.03c PE=3 SV=1 30 180 8.0E-32
sp|P53073|EMC4_YEAST ER membrane protein complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC4 PE=1 SV=1 17 171 4.0E-26
sp|Q6GR43|EMC4_XENLA ER membrane protein complex subunit 4 OS=Xenopus laevis GN=emc4 PE=2 SV=1 57 168 4.0E-21
sp|Q6PBF7|EMC4_XENTR ER membrane protein complex subunit 4 OS=Xenopus tropicalis GN=emc4 PE=2 SV=1 57 168 3.0E-20
sp|Q6P011|EMC4_DANRE ER membrane protein complex subunit 4 OS=Danio rerio GN=emc4 PE=2 SV=1 47 177 5.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94520|YQ13_SCHPO ER membrane protein complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1281.03c PE=3 SV=1 30 180 8.0E-32
sp|P53073|EMC4_YEAST ER membrane protein complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC4 PE=1 SV=1 17 171 4.0E-26
sp|Q6GR43|EMC4_XENLA ER membrane protein complex subunit 4 OS=Xenopus laevis GN=emc4 PE=2 SV=1 57 168 4.0E-21
sp|Q6PBF7|EMC4_XENTR ER membrane protein complex subunit 4 OS=Xenopus tropicalis GN=emc4 PE=2 SV=1 57 168 3.0E-20
sp|Q6P011|EMC4_DANRE ER membrane protein complex subunit 4 OS=Danio rerio GN=emc4 PE=2 SV=1 47 177 5.0E-20
sp|B5XB24|EMC4_SALSA ER membrane protein complex subunit 4 OS=Salmo salar GN=emc4 PE=2 SV=1 47 168 5.0E-20
sp|Q9CZX9|EMC4_MOUSE ER membrane protein complex subunit 4 OS=Mus musculus GN=Emc4 PE=1 SV=1 41 168 1.0E-19
sp|Q5RC35|EMC4_PONAB ER membrane protein complex subunit 4 OS=Pongo abelii GN=EMC4 PE=2 SV=1 41 168 1.0E-19
sp|Q5J8M3|EMC4_HUMAN ER membrane protein complex subunit 4 OS=Homo sapiens GN=EMC4 PE=1 SV=2 41 168 1.0E-19
sp|Q3T0K8|EMC4_BOVIN ER membrane protein complex subunit 4 OS=Bos taurus GN=EMC4 PE=2 SV=1 57 168 2.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 94 116 22
2 137 159 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 171.67 93.63 249.71
CcL In ants, during behavior modification 210.24 113.90 306.56
CcD In ants, recently dead 226.23 122.78 329.67

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.403696 no
SC16a CcD 0.241043 no
CcL CcD 0.789085 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3754
MASSTPTPAVPPWIIQLDTPPVGRNRVPGIPDPPGFSSSSGSKKKDPRAQPKRPAPTQDEMETLKLKKAWEVALA
PVKSLPMTAIMMYMSGNSLQIFSIMMVFMAFKNPLVGLISTNQAFEKFRTDSNEAKLLQTKVVYVAMQLVALAVG
VWKVNAMGLLPTTRSDWLMWESQRLSVDRAVTAL
Coding >Ophio5|3754
ATGGCTTCGTCGACTCCCACACCCGCCGTCCCTCCCTGGATCATCCAGCTCGACACTCCGCCGGTAGGCAGGAAT
CGTGTGCCCGGCATCCCGGACCCGCCGGGCTTCTCCAGCTCTTCCGGCTCCAAGAAAAAGGATCCGAGAGCGCAG
CCGAAAAGACCCGCCCCGACACAAGACGAGATGGAGACGCTCAAGCTCAAGAAGGCGTGGGAGGTGGCCCTCGCC
CCCGTCAAGTCGCTGCCCATGACGGCCATCATGATGTACATGTCGGGAAACTCGCTGCAGATATTTAGCATCATG
ATGGTCTTCATGGCCTTTAAGAATCCCCTGGTCGGCTTAATCAGCACCAATCAGGCCTTTGAGAAGTTTCGAACC
GACAGCAACGAGGCCAAGCTGTTGCAGACCAAGGTCGTCTACGTCGCTATGCAACTTGTGGCATTGGCCGTCGGC
GTCTGGAAAGTCAACGCCATGGGTCTCTTGCCGACAACTCGATCGGACTGGCTCATGTGGGAGTCCCAGAGGCTG
TCTGTGGATCGGGCTGTAACAGCTTTG
Transcript >Ophio5|3754
ATGGCTTCGTCGACTCCCACACCCGCCGTCCCTCCCTGGATCATCCAGCTCGACACTCCGCCGGTAGGCAGGAAT
CGTGTGCCCGGCATCCCGGACCCGCCGGGCTTCTCCAGCTCTTCCGGCTCCAAGAAAAAGGATCCGAGAGCGCAG
CCGAAAAGACCCGCCCCGACACAAGACGAGATGGAGACGCTCAAGCTCAAGAAGGCGTGGGAGGTGGCCCTCGCC
CCCGTCAAGTCGCTGCCCATGACGGCCATCATGATGTACATGTCGGGAAACTCGCTGCAGATATTTAGCATCATG
ATGGTCTTCATGGCCTTTAAGAATCCCCTGGTCGGCTTAATCAGCACCAATCAGGCCTTTGAGAAGTTTCGAACC
GACAGCAACGAGGCCAAGCTGTTGCAGACCAAGGTCGTCTACGTCGCTATGCAACTTGTGGCATTGGCCGTCGGC
GTCTGGAAAGTCAACGCCATGGGTCTCTTGCCGACAACTCGATCGGACTGGCTCATGTGGGAGTCCCAGAGGCTG
TCTGTGGATCGGGCTGTAACAGCTTTGTGA
Gene >Ophio5|3754
ATGGCTTCGTCGACTCCCACACCCGCCGTCCCTCCCTGGATCATCCAGCTCGACACTCCGCCGGTAGGCAGGAAT
CGTGTGCCCGGCATCCCGGACCCGCCGGGCTTCTCCAGCTCTTCCGGCTCCAAGGTGAGAGAGAGAGACTGCGCG
CGCGCGAGAGAGAGAGAGAGAGTCTCGCTTTCTCGCACGACACAGCAAGAGGCTAACGGATTATCACAGAAAAAG
GATCCGAGAGCGCAGCCGAAAAGACCCGCCCCGACACAAGACGAGATGGAGACGCTCAAGCTCAAGAAGGCGTGG
GAGGTGGCCCTCGCCCCCGTCAAGTCGCTGCCCATGACGGCCATCATGATGTACATGTCGGGAAACTCGCTGCAG
ATATTTAGCATCATGATGGTCTTCATGGCCTTTAAGAATCCCCTGGTCGGCTTAATCAGCACCAATCAGGCCTTT
GAGAAGTTTCGAACCGACAGCAACGAGGCCAAGCTGTTGCAGACCAAGGTCGTCTACGTCGCTATGCAACTTGTG
GCATTGGCCGTCGGCGTCTGGAAAGTCAACGCCATGGGTCTCTTGCCGTGCGTATCCATGTCGCGCCGGGCAGCT
AGCCAGGCTGACAGCAAGAACAGGACAACTCGATCGGACTGGCTCATGTGGGAGTCCCAGAGGCTGTCTGTGGAT
CGGGCTGTAACAGCTTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail