Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3748
Gene name
Locationscaffold_296:2777..5025
Strand+
Gene length (bp)2248
Transcript length (bp)2001
Coding sequence length (bp)1998
Protein length (aa) 666

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 47 69 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 114.58 59.49 169.68
CcL In ants, during behavior modification 121.84 58.85 184.84
CcD In ants, recently dead 121.25 62.33 180.17

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.841242 no
SC16a CcD 0.846091 no
CcL CcD 0.987964 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3748
MARPRAWSLSQLWRDDEEMAKKDDDHNARRPPPLQWTAAVRAPRPSWLLRLISYLLVACAVVFLVYHAAGFGYRD
DRYLPLSSRGQDSSQHRLRPPGFDSVSRAQSDAAGQRQVQDGPIQHMELLASIRALAATGSGLNRNRNVLFAAAS
LQSAATLLPMACSMARELHSYVHFAFMGRSDIPMQELLKINGIDQSCPLLLHDARPDYAATSTEERMILAVERAM
IIIHRLVPPQVVLVDSTMAEEPYFHHGTRKYIDRFQTTLIELPEKPGTRLSWITKLDSSALAAWDKVRFDIIVHS
PRTGTGNLKRLLQSLARADLGGHQVPHLVVELPSVVEAPLEKFLAGFKWPPPNSGAERAPSMLSLRHRISRPRLT
EEESSVRLLESFWPTNPSLSHVLYLSPHMEISPYFFHYVKYCLLFRRHSRMAAGEFLSSSIMAMSFAVPTTLASG
KQPFSPPRLPSGGGAQAEGTSFLWQAPTSDAVLFLGDKWVELHGYVARVLEAQKAISDPPALLANKQVGRQVPAW
VEYALQLSRLRGYLTLYPGQDTANAIATAHSDLSDEPEEFGPPTASVDRGRQTEDGQVIGVSEAASQVDMLEALP
DEGLQRRLDELPLLSWDGRLLGEGETLGKDAMELATDFRRQVGQCTEDELEGQILADKHARDLFCR
Coding >Ophio5|3748
ATGGCAAGGCCAAGAGCCTGGTCCCTTTCGCAGCTGTGGCGCGACGACGAGGAGATGGCCAAGAAGGACGATGAT
CACAACGCTAGGCGTCCTCCTCCCCTCCAGTGGACTGCCGCCGTGCGAGCCCCCCGGCCATCGTGGCTGCTGCGC
CTCATATCCTACCTCTTGGTCGCCTGTGCCGTCGTCTTCCTCGTCTATCATGCTGCCGGCTTCGGATACCGCGAC
GATCGTTATCTTCCCCTCTCCTCGAGGGGTCAGGACTCATCGCAACACCGACTGCGGCCACCCGGCTTCGACTCC
GTCTCCAGGGCACAGTCTGACGCTGCAGGCCAGCGCCAGGTCCAAGACGGGCCCATCCAGCACATGGAGCTCTTG
GCCTCTATCAGAGCCCTAGCCGCCACCGGTAGCGGCCTCAACAGGAACCGTAATGTCTTATTCGCCGCCGCGAGC
CTCCAGAGCGCCGCGACTCTCCTCCCCATGGCCTGCAGCATGGCTCGGGAGCTCCACAGCTATGTCCATTTCGCC
TTCATGGGCAGGTCCGACATACCCATGCAAGAATTGCTCAAGATCAACGGCATCGACCAGTCCTGCCCTCTGCTG
TTACACGATGCGCGGCCCGATTACGCTGCCACGTCGACCGAGGAGCGCATGATCCTGGCAGTCGAGCGAGCAATG
ATCATCATCCACCGCCTTGTGCCTCCTCAGGTCGTTCTCGTCGATTCTACCATGGCCGAGGAACCCTACTTCCAC
CACGGTACCCGGAAGTACATTGACAGATTTCAGACGACCCTCATCGAGCTCCCCGAAAAGCCAGGGACCCGCCTG
TCTTGGATCACCAAGCTTGACTCCTCGGCCCTCGCTGCCTGGGACAAGGTTCGTTTTGACATCATTGTTCACAGT
CCACGGACTGGGACCGGAAACCTCAAGCGGCTGCTTCAGTCCTTGGCCCGCGCCGATCTTGGTGGCCATCAGGTC
CCCCATCTCGTCGTCGAGCTGCCCTCGGTCGTCGAAGCGCCCCTGGAAAAGTTCTTGGCGGGCTTCAAATGGCCG
CCACCCAACTCGGGCGCAGAACGGGCGCCATCCATGCTGTCGTTGCGCCATCGCATCTCGCGGCCGAGATTAACC
GAGGAGGAGAGTTCGGTTCGATTGCTGGAGTCGTTTTGGCCTACGAATCCTTCTCTCTCACATGTGCTATATCTG
TCACCGCACATGGAGATTAGTCCATACTTTTTTCACTACGTCAAATATTGCCTTCTCTTCCGACGACACTCCCGT
ATGGCGGCCGGCGAGTTCTTAAGCTCCAGCATCATGGCAATGAGCTTCGCCGTTCCGACCACCTTGGCCAGCGGT
AAGCAGCCGTTTAGTCCTCCGCGGCTGCCGTCAGGCGGAGGAGCTCAGGCCGAGGGAACGTCCTTTCTCTGGCAA
GCGCCGACGAGCGACGCCGTGCTGTTTTTGGGCGACAAATGGGTCGAGCTGCACGGTTACGTCGCTCGGGTGTTG
GAGGCGCAGAAGGCCATCTCGGACCCGCCAGCGCTGCTCGCCAACAAGCAGGTGGGCCGGCAAGTTCCGGCTTGG
GTCGAGTACGCGTTGCAGCTTTCGCGTCTGCGAGGCTACCTTACGCTCTACCCCGGTCAGGATACGGCCAACGCC
ATTGCCACTGCGCACAGCGATCTGTCTGATGAGCCGGAGGAGTTTGGACCGCCGACGGCCTCGGTCGACAGGGGG
CGGCAGACGGAGGACGGCCAAGTGATTGGCGTCTCCGAGGCTGCGTCGCAAGTCGACATGCTCGAGGCGTTGCCG
GACGAGGGGCTGCAGAGGCGGCTGGATGAGTTGCCGCTCCTATCATGGGACGGGCGGCTGCTAGGCGAGGGAGAG
ACGCTTGGAAAAGATGCCATGGAGCTCGCGACGGACTTTCGCCGTCAGGTTGGGCAGTGCACCGAGGATGAGCTG
GAGGGACAGATATTGGCGGACAAGCATGCGCGAGACCTGTTCTGCAGG
Transcript >Ophio5|3748
ATGGCAAGGCCAAGAGCCTGGTCCCTTTCGCAGCTGTGGCGCGACGACGAGGAGATGGCCAAGAAGGACGATGAT
CACAACGCTAGGCGTCCTCCTCCCCTCCAGTGGACTGCCGCCGTGCGAGCCCCCCGGCCATCGTGGCTGCTGCGC
CTCATATCCTACCTCTTGGTCGCCTGTGCCGTCGTCTTCCTCGTCTATCATGCTGCCGGCTTCGGATACCGCGAC
GATCGTTATCTTCCCCTCTCCTCGAGGGGTCAGGACTCATCGCAACACCGACTGCGGCCACCCGGCTTCGACTCC
GTCTCCAGGGCACAGTCTGACGCTGCAGGCCAGCGCCAGGTCCAAGACGGGCCCATCCAGCACATGGAGCTCTTG
GCCTCTATCAGAGCCCTAGCCGCCACCGGTAGCGGCCTCAACAGGAACCGTAATGTCTTATTCGCCGCCGCGAGC
CTCCAGAGCGCCGCGACTCTCCTCCCCATGGCCTGCAGCATGGCTCGGGAGCTCCACAGCTATGTCCATTTCGCC
TTCATGGGCAGGTCCGACATACCCATGCAAGAATTGCTCAAGATCAACGGCATCGACCAGTCCTGCCCTCTGCTG
TTACACGATGCGCGGCCCGATTACGCTGCCACGTCGACCGAGGAGCGCATGATCCTGGCAGTCGAGCGAGCAATG
ATCATCATCCACCGCCTTGTGCCTCCTCAGGTCGTTCTCGTCGATTCTACCATGGCCGAGGAACCCTACTTCCAC
CACGGTACCCGGAAGTACATTGACAGATTTCAGACGACCCTCATCGAGCTCCCCGAAAAGCCAGGGACCCGCCTG
TCTTGGATCACCAAGCTTGACTCCTCGGCCCTCGCTGCCTGGGACAAGGTTCGTTTTGACATCATTGTTCACAGT
CCACGGACTGGGACCGGAAACCTCAAGCGGCTGCTTCAGTCCTTGGCCCGCGCCGATCTTGGTGGCCATCAGGTC
CCCCATCTCGTCGTCGAGCTGCCCTCGGTCGTCGAAGCGCCCCTGGAAAAGTTCTTGGCGGGCTTCAAATGGCCG
CCACCCAACTCGGGCGCAGAACGGGCGCCATCCATGCTGTCGTTGCGCCATCGCATCTCGCGGCCGAGATTAACC
GAGGAGGAGAGTTCGGTTCGATTGCTGGAGTCGTTTTGGCCTACGAATCCTTCTCTCTCACATGTGCTATATCTG
TCACCGCACATGGAGATTAGTCCATACTTTTTTCACTACGTCAAATATTGCCTTCTCTTCCGACGACACTCCCGT
ATGGCGGCCGGCGAGTTCTTAAGCTCCAGCATCATGGCAATGAGCTTCGCCGTTCCGACCACCTTGGCCAGCGGT
AAGCAGCCGTTTAGTCCTCCGCGGCTGCCGTCAGGCGGAGGAGCTCAGGCCGAGGGAACGTCCTTTCTCTGGCAA
GCGCCGACGAGCGACGCCGTGCTGTTTTTGGGCGACAAATGGGTCGAGCTGCACGGTTACGTCGCTCGGGTGTTG
GAGGCGCAGAAGGCCATCTCGGACCCGCCAGCGCTGCTCGCCAACAAGCAGGTGGGCCGGCAAGTTCCGGCTTGG
GTCGAGTACGCGTTGCAGCTTTCGCGTCTGCGAGGCTACCTTACGCTCTACCCCGGTCAGGATACGGCCAACGCC
ATTGCCACTGCGCACAGCGATCTGTCTGATGAGCCGGAGGAGTTTGGACCGCCGACGGCCTCGGTCGACAGGGGG
CGGCAGACGGAGGACGGCCAAGTGATTGGCGTCTCCGAGGCTGCGTCGCAAGTCGACATGCTCGAGGCGTTGCCG
GACGAGGGGCTGCAGAGGCGGCTGGATGAGTTGCCGCTCCTATCATGGGACGGGCGGCTGCTAGGCGAGGGAGAG
ACGCTTGGAAAAGATGCCATGGAGCTCGCGACGGACTTTCGCCGTCAGGTTGGGCAGTGCACCGAGGATGAGCTG
GAGGGACAGATATTGGCGGACAAGCATGCGCGAGACCTGTTCTGCAGGTGA
Gene >Ophio5|3748
ATGGCAAGGCCAAGAGCCTGGTCCCTTTCGCAGCTGTGGCGCGACGACGAGGAGATGGCCAAGAAGGACGATGAT
CACAACGCTAGGCGTCCTCCTCCCCTCCAGTGGACTGCCGCCGTGCGAGCCCCCCGGCCATCGTGGCTGCTGCGC
CTCATATCCTACCTCTTGGTCGCCTGTGCCGTCGTCTTCCTCGTCTATCATGCTGCCGGCTTCGGATACCGCGAC
GATCGTTATCTTCCCCTCTCCTCGAGGGGTCAGGACTCATCGCAACACCGACTGCGGCCACCCGGCTTCGACTCC
GTCTCCAGGGCACAGTCTGACGCTGCAGGCCAGCGCCAGGTCCAAGACGGGCCCATCCAGCACATGGAGCTCTTG
GCCTCTATCAGAGCCCTAGCCGCCACCGGTAGCGGCCTCAACAGGAACCGTAATGTCTTATTCGCCGCCGCGAGC
CTCCAGAGCGCCGCGACTCTCCTCCCCATGGCCTGCAGCATGGCTCGGGAGCTCCACAGCTATGTCCATTTCGCC
TTCATGGGCAGGTCCGACATACCCATGCAAGAATTGCTCAAGATCAACGGCATCGACCAGTCCTGCCCTCTGCTG
TTACACGGTATGTACGCAGCCGTGCTTCCTCCACGTCATCACTGACGATAGCTTCTAGATGCGCGGCCCGATTAC
GCTGCCACGTCGACCGAGGAGCGCATGATCCTGGCAGTCGAGCGAGCAATGAGTGAGGCCCCTACCTCCCCCAGA
CCGAGCGTCTGCCTCCCTCAGACCGAGCGTCTACCTCCCGTTGCGCAATCCTTCTGACCCAGCCGCAGTCATCAT
CCACCGCCTTGTGCCTCCTCAGGTCGTTCTCGTCGATTCTACCATGGCCGAGGAACCCTACTTCCACCACGGTAC
CCGGAAGTACATTGACAGATTTCAGACGACCCTCATCGAGCTCCCCGAAAAGCCAGGGACCCGCCTGTCTTGGAT
CACCAAGCTTGACTCCTCGGCCCTCGCTGGTAGGTCCCCTTTGCCCTTGCGCCCTCGGGAGGCACGAGTCCTAAC
CCTTGACTAGCCTGGGACAAGGTTCGTTTTGACATCATTGTTCACAGTCCACGGACTGGGACCGGAAACCTCAAG
CGGCTGCTTCAGTCCTTGGCCCGCGCCGATCTTGGTGGCCATCAGGTCCCCCATCTCGTCGTCGAGCTGCCCTCG
GTCGTCGAAGCGCCCCTGGAAAAGTTCTTGGCGGGCTTCAAATGGCCGCCACCCAACTCGGGCGCAGAACGGGCG
CCATCCATGCTGTCGTTGCGCCATCGCATCTCGCGGCCGAGATTAACCGAGGAGGAGAGTTCGGTTCGATTGCTG
GAGTCGTTTTGGCCTACGAATCCTTCTCTCTCACATGTGCTATATCTGTCACCGCACATGGAGATTAGTCCATAC
TTTTTTCACTGTAAGTTTGCTCTTACTGCGCGTCGCGCTCGACGACTGACAAGAAGTAGACGTCAAATATTGCCT
TCTCTTCCGACGACACTCCCGTATGGCGGCCGGCGAGTTCTTAAGCTCCAGCATCATGGCAATGAGCTTCGCCGT
TCCGACCACCTTGGCCAGCGGTAAGCAGCCGTTTAGTCCTCCGCGGCTGCCGTCAGGCGGAGGAGCTCAGGCCGA
GGGAACGTCCTTTCTCTGGCAAGCGCCGACGAGCGACGCCGTGCTGTTTTTGGGCGACAAATGGGTCGAGCTGCA
CGGTTACGTCGCTCGGGTGTTGGAGGCGCAGAAGGCCATCTCGGACCCGCCAGCGCTGCTCGCCAACAAGCAGGT
GGGCCGGCAAGTTCCGGCTTGGGTCGAGTACGCGTTGCAGCTTTCGCGTCTGCGAGGCTACCTTACGCTCTACCC
CGGTCAGGATACGGCCAACGCCATTGCCACTGCGCACAGCGATCTGTCTGATGAGCCGGAGGAGTTTGGACCGCC
GACGGCCTCGGTCGACAGGGGGCGGCAGACGGAGGACGGCCAAGTGATTGGCGTCTCCGAGGCTGCGTCGCAAGT
CGACATGCTCGAGGCGTTGCCGGACGAGGGGCTGCAGAGGCGGCTGGATGAGTTGCCGCTCCTATCATGGGACGG
GCGGCTGCTAGGCGAGGGAGAGACGCTTGGAAAAGATGCCATGGAGCTCGCGACGGACTTTCGCCGTCAGGTTGG
GCAGTGCACCGAGGATGAGCTGGAGGGACAGATATTGGCGGACAAGCATGCGCGAGACCTGTTCTGCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail