Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3738
Gene name
Locationscaffold_295:6089..7493
Strand+
Gene length (bp)1404
Transcript length (bp)1338
Coding sequence length (bp)1335
Protein length (aa) 445

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01733 Nucleoside_tran Nucleoside transporter 2.8E-39 146 442

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31381|FUN26_YEAST Nucleoside transporter FUN26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN26 PE=1 SV=1 14 440 1.0E-44
sp|O54698|S29A1_RAT Equilibrative nucleoside transporter 1 OS=Rattus norvegicus GN=Slc29a1 PE=1 SV=3 39 440 9.0E-21
sp|Q9JIM1|S29A1_MOUSE Equilibrative nucleoside transporter 1 OS=Mus musculus GN=Slc29a1 PE=1 SV=3 36 440 8.0E-17
sp|Q99808|S29A1_HUMAN Equilibrative nucleoside transporter 1 OS=Homo sapiens GN=SLC29A1 PE=1 SV=3 36 440 1.0E-14
sp|Q8R139|S29A4_MOUSE Equilibrative nucleoside transporter 4 OS=Mus musculus GN=Slc29a4 PE=1 SV=1 46 440 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31381|FUN26_YEAST Nucleoside transporter FUN26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN26 PE=1 SV=1 14 440 1.0E-44
sp|O54698|S29A1_RAT Equilibrative nucleoside transporter 1 OS=Rattus norvegicus GN=Slc29a1 PE=1 SV=3 39 440 9.0E-21
sp|Q9JIM1|S29A1_MOUSE Equilibrative nucleoside transporter 1 OS=Mus musculus GN=Slc29a1 PE=1 SV=3 36 440 8.0E-17
sp|Q99808|S29A1_HUMAN Equilibrative nucleoside transporter 1 OS=Homo sapiens GN=SLC29A1 PE=1 SV=3 36 440 1.0E-14
sp|Q8R139|S29A4_MOUSE Equilibrative nucleoside transporter 4 OS=Mus musculus GN=Slc29a4 PE=1 SV=1 46 440 2.0E-13
sp|A1A4N1|S29A3_BOVIN Equilibrative nucleoside transporter 3 OS=Bos taurus GN=SLC29A3 PE=2 SV=1 4 431 2.0E-13
sp|Q84XI3|ENT8_ARATH Equilibrative nucleotide transporter 8 OS=Arabidopsis thaliana GN=ETN8 PE=2 SV=1 9 440 7.0E-13
sp|Q9BZD2|S29A3_HUMAN Equilibrative nucleoside transporter 3 OS=Homo sapiens GN=SLC29A3 PE=1 SV=3 4 436 1.0E-12
sp|Q14542|S29A2_HUMAN Equilibrative nucleoside transporter 2 OS=Homo sapiens GN=SLC29A2 PE=1 SV=3 42 440 1.0E-12
sp|Q80WK7|S29A3_RAT Equilibrative nucleoside transporter 3 OS=Rattus norvegicus GN=Slc29a3 PE=1 SV=2 4 436 4.0E-12
sp|O54699|S29A2_RAT Equilibrative nucleoside transporter 2 OS=Rattus norvegicus GN=Slc29a2 PE=2 SV=1 42 440 2.0E-11
sp|Q8VXY7|ENT1_ARATH Equilibrative nucleotide transporter 1 OS=Arabidopsis thaliana GN=ENT1 PE=1 SV=1 18 439 4.0E-11
sp|Q99P65|S29A3_MOUSE Equilibrative nucleoside transporter 3 OS=Mus musculus GN=Slc29a3 PE=1 SV=1 4 436 9.0E-11
sp|Q61672|S29A2_MOUSE Equilibrative nucleoside transporter 2 OS=Mus musculus GN=Slc29a2 PE=1 SV=2 42 440 1.0E-10
sp|Q7RTT9|S29A4_HUMAN Equilibrative nucleoside transporter 4 OS=Homo sapiens GN=SLC29A4 PE=1 SV=1 290 440 2.0E-08
sp|A1L272|S29A4_DANRE Equilibrative nucleoside transporter 4 OS=Danio rerio GN=slc29a4 PE=2 SV=1 305 440 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:1901642 nucleoside transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005337 nucleoside transmembrane transporter activity Yes
GO:0005215 transporter activity No
GO:0015931 nucleobase-containing compound transport No
GO:0008150 biological_process No
GO:0015858 nucleoside transport No
GO:0071705 nitrogen compound transport No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0055085 transmembrane transport No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0071702 organic substance transport No
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:1901264 carbohydrate derivative transport No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 77 96 19
3 109 131 22
4 136 155 19
5 175 197 22
6 217 239 22
7 281 303 22
8 351 370 19
9 383 405 22
10 420 442 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3738
MDRSRAAYERLGADDDDDDDARLERSVLVDGPPFSWLEYTIFGFLGVAMLWAWNMFLAAAPYFSSRFASDPWIEA
NFQSAILASSTLVNLGTLIVLTNLQREASYTFRINLALVINTIVFALLTCSTALFLDASPAVYLVFLLLIVAAAS
WATGLSQNGCFAFAASFGRPEYTQALMAGQSIAGVLPAVAQVATVLLFPPHHHSTTDPVPSKGQTSAFVYFLTAV
AISVAALVALAALVRRHRAMLDSRLPNGMAASVTSIQDAERAARKVASLWHLFAKLRWLAVGVALTFAATMFFPV
FTTKTLSVHPGAAPLFRSAAFIPLAFLCWNLGDLGGRVLAVLPFSLRHKPFLLFVLSVLRIGQLPLYLLCNIGGR
GAAVPSDFFYLVVVQLLFGMTNGWLGSSFMMAAGEWVEPGEREAAGGFMGLCLVVGLTVGSFLSFTISDI
Coding >Ophio5|3738
ATGGATCGATCGAGGGCCGCATACGAGCGTCTGGGCGCCGACGACGACGACGACGACGATGCCCGCTTGGAACGC
TCCGTCCTCGTCGATGGGCCGCCTTTTTCTTGGCTCGAGTACACCATCTTTGGCTTCCTCGGCGTTGCCATGCTC
TGGGCTTGGAATATGTTCCTCGCTGCCGCGCCTTACTTCTCCTCTCGCTTCGCCTCCGATCCCTGGATAGAGGCA
AACTTTCAGTCGGCTATTCTCGCCTCCTCGACGCTCGTCAACCTCGGCACCCTCATCGTCCTCACCAACTTACAA
CGCGAAGCCTCGTACACGTTCCGCATCAACCTCGCCCTCGTCATCAACACCATCGTATTTGCCCTCCTCACTTGC
TCCACCGCCCTCTTTCTCGACGCCTCTCCTGCCGTCTACCTCGTCTTTCTGCTCCTGATTGTCGCCGCCGCCTCG
TGGGCCACGGGCCTGAGCCAGAACGGCTGCTTCGCCTTCGCCGCCAGCTTCGGCCGCCCCGAATATACCCAGGCT
CTCATGGCCGGACAGAGCATCGCTGGTGTCCTGCCCGCCGTCGCCCAGGTCGCTACCGTCCTTCTCTTCCCGCCA
CACCATCATTCCACCACCGACCCCGTCCCCAGCAAGGGCCAGACATCGGCCTTTGTCTACTTTCTCACCGCCGTC
GCCATCTCCGTCGCCGCTCTCGTCGCCCTCGCCGCTCTCGTTCGGAGACATCGCGCCATGTTGGACAGCCGACTG
CCGAACGGCATGGCCGCCTCCGTCACCAGCATCCAGGACGCCGAGCGCGCCGCCCGCAAGGTCGCCTCGCTTTGG
CACCTCTTCGCCAAGCTCCGCTGGCTCGCCGTCGGCGTCGCCCTCACCTTTGCCGCCACCATGTTCTTCCCCGTC
TTCACCACCAAGACGCTCTCCGTCCATCCCGGCGCCGCTCCGCTCTTCCGCTCGGCCGCCTTTATCCCCCTCGCC
TTTCTCTGCTGGAACCTCGGCGACCTCGGCGGCAGGGTTCTCGCCGTCCTACCCTTCTCTCTCAGGCACAAGCCC
TTTTTGCTCTTCGTCCTCTCCGTACTACGAATCGGCCAGCTCCCGCTCTATCTCCTCTGTAACATCGGTGGCCGA
GGCGCCGCCGTTCCCAGCGACTTCTTCTACCTCGTCGTCGTCCAGCTGTTATTTGGCATGACCAATGGTTGGCTG
GGCTCGAGCTTCATGATGGCTGCTGGCGAGTGGGTTGAGCCGGGTGAGCGCGAGGCAGCCGGCGGCTTCATGGGC
CTCTGCCTCGTCGTCGGCTTGACCGTGGGCAGCTTCCTGAGCTTTACCATATCCGACATA
Transcript >Ophio5|3738
ATGGATCGATCGAGGGCCGCATACGAGCGTCTGGGCGCCGACGACGACGACGACGACGATGCCCGCTTGGAACGC
TCCGTCCTCGTCGATGGGCCGCCTTTTTCTTGGCTCGAGTACACCATCTTTGGCTTCCTCGGCGTTGCCATGCTC
TGGGCTTGGAATATGTTCCTCGCTGCCGCGCCTTACTTCTCCTCTCGCTTCGCCTCCGATCCCTGGATAGAGGCA
AACTTTCAGTCGGCTATTCTCGCCTCCTCGACGCTCGTCAACCTCGGCACCCTCATCGTCCTCACCAACTTACAA
CGCGAAGCCTCGTACACGTTCCGCATCAACCTCGCCCTCGTCATCAACACCATCGTATTTGCCCTCCTCACTTGC
TCCACCGCCCTCTTTCTCGACGCCTCTCCTGCCGTCTACCTCGTCTTTCTGCTCCTGATTGTCGCCGCCGCCTCG
TGGGCCACGGGCCTGAGCCAGAACGGCTGCTTCGCCTTCGCCGCCAGCTTCGGCCGCCCCGAATATACCCAGGCT
CTCATGGCCGGACAGAGCATCGCTGGTGTCCTGCCCGCCGTCGCCCAGGTCGCTACCGTCCTTCTCTTCCCGCCA
CACCATCATTCCACCACCGACCCCGTCCCCAGCAAGGGCCAGACATCGGCCTTTGTCTACTTTCTCACCGCCGTC
GCCATCTCCGTCGCCGCTCTCGTCGCCCTCGCCGCTCTCGTTCGGAGACATCGCGCCATGTTGGACAGCCGACTG
CCGAACGGCATGGCCGCCTCCGTCACCAGCATCCAGGACGCCGAGCGCGCCGCCCGCAAGGTCGCCTCGCTTTGG
CACCTCTTCGCCAAGCTCCGCTGGCTCGCCGTCGGCGTCGCCCTCACCTTTGCCGCCACCATGTTCTTCCCCGTC
TTCACCACCAAGACGCTCTCCGTCCATCCCGGCGCCGCTCCGCTCTTCCGCTCGGCCGCCTTTATCCCCCTCGCC
TTTCTCTGCTGGAACCTCGGCGACCTCGGCGGCAGGGTTCTCGCCGTCCTACCCTTCTCTCTCAGGCACAAGCCC
TTTTTGCTCTTCGTCCTCTCCGTACTACGAATCGGCCAGCTCCCGCTCTATCTCCTCTGTAACATCGGTGGCCGA
GGCGCCGCCGTTCCCAGCGACTTCTTCTACCTCGTCGTCGTCCAGCTGTTATTTGGCATGACCAATGGTTGGCTG
GGCTCGAGCTTCATGATGGCTGCTGGCGAGTGGGTTGAGCCGGGTGAGCGCGAGGCAGCCGGCGGCTTCATGGGC
CTCTGCCTCGTCGTCGGCTTGACCGTGGGCAGCTTCCTGAGCTTTACCATATCCGACATATAG
Gene >Ophio5|3738
ATGGATCGATCGAGGGCCGCATACGAGCGTCTGGGCGCCGACGACGACGACGACGACGATGCCCGCTTGGAACGC
TCCGTCCTCGTCGATGGGCCGCCTTTTTCTTGGCTCGAGTACACCATCTTTGGCTTCCTCGGCGTTGCCATGCTC
TGGGCTTGGTATGGCTTCTCCTCCCCCTTCAAAGGACGAGCCTTCGCGCGCTCTTGCTGACGCCGAACCTGTAGG
AATATGTTCCTCGCTGCCGCGCCTTACTTCTCCTCTCGCTTCGCCTCCGATCCCTGGATAGAGGCAAACTTTCAG
TCGGCTATTCTCGCCTCCTCGACGCTCGTCAACCTCGGCACCCTCATCGTCCTCACCAACTTACAACGCGAAGCC
TCGTACACGTTCCGCATCAACCTCGCCCTCGTCATCAACACCATCGTATTTGCCCTCCTCACTTGCTCCACCGCC
CTCTTTCTCGACGCCTCTCCTGCCGTCTACCTCGTCTTTCTGCTCCTGATTGTCGCCGCCGCCTCGTGGGCCACG
GGCCTGAGCCAGAACGGCTGCTTCGCCTTCGCCGCCAGCTTCGGCCGCCCCGAATATACCCAGGCTCTCATGGCC
GGACAGAGCATCGCTGGTGTCCTGCCCGCCGTCGCCCAGGTCGCTACCGTCCTTCTCTTCCCGCCACACCATCAT
TCCACCACCGACCCCGTCCCCAGCAAGGGCCAGACATCGGCCTTTGTCTACTTTCTCACCGCCGTCGCCATCTCC
GTCGCCGCTCTCGTCGCCCTCGCCGCTCTCGTTCGGAGACATCGCGCCATGTTGGACAGCCGACTGCCGAACGGC
ATGGCCGCCTCCGTCACCAGCATCCAGGACGCCGAGCGCGCCGCCCGCAAGGTCGCCTCGCTTTGGCACCTCTTC
GCCAAGCTCCGCTGGCTCGCCGTCGGCGTCGCCCTCACCTTTGCCGCCACCATGTTCTTCCCCGTCTTCACCACC
AAGACGCTCTCCGTCCATCCCGGCGCCGCTCCGCTCTTCCGCTCGGCCGCCTTTATCCCCCTCGCCTTTCTCTGC
TGGAACCTCGGCGACCTCGGCGGCAGGGTTCTCGCCGTCCTACCCTTCTCTCTCAGGCACAAGCCCTTTTTGCTC
TTCGTCCTCTCCGTACTACGAATCGGCCAGCTCCCGCTCTATCTCCTCTGTAACATCGGTGGCCGAGGCGCCGCC
GTTCCCAGCGACTTCTTCTACCTCGTCGTCGTCCAGCTGTTATTTGGCATGACCAATGGTTGGCTGGGCTCGAGC
TTCATGATGGCTGCTGGCGAGTGGGTTGAGCCGGGTGAGCGCGAGGCAGCCGGCGGCTTCATGGGCCTCTGCCTC
GTCGTCGGCTTGACCGTGGGCAGCTTCCTGAGCTTTACCATATCCGACATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail