Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3736
Gene name
Locationscaffold_295:165..2451
Strand-
Gene length (bp)2286
Transcript length (bp)2187
Coding sequence length (bp)2184
Protein length (aa) 728

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00199 Catalase Catalase 8.1E-163 62 445
PF18011 Catalase_C C-terminal domain found in long catalases 4.2E-47 573 716
PF06628 Catalase-rel Catalase-related immune-responsive 2.7E-16 477 540

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C169|CAT3_NEUCR Catalase-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cat-3 PE=1 SV=1 1 719 0.0E+00
sp|Q877A8|CATB_ASPOR Catalase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=catB PE=2 SV=1 10 718 0.0E+00
sp|Q92405|CATB_ASPFU Catalase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=catB PE=1 SV=1 17 718 0.0E+00
sp|P78619|CATB_EMENI Catalase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=catB PE=2 SV=2 1 718 0.0E+00
sp|Q8X1P0|CATA_BLUGH Catalase OS=Blumeria graminis f. sp. hordei GN=CAT1 PE=3 SV=1 13 718 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C169|CAT3_NEUCR Catalase-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cat-3 PE=1 SV=1 1 719 0.0E+00
sp|Q877A8|CATB_ASPOR Catalase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=catB PE=2 SV=1 10 718 0.0E+00
sp|Q92405|CATB_ASPFU Catalase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=catB PE=1 SV=1 17 718 0.0E+00
sp|P78619|CATB_EMENI Catalase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=catB PE=2 SV=2 1 718 0.0E+00
sp|Q8X1P0|CATA_BLUGH Catalase OS=Blumeria graminis f. sp. hordei GN=CAT1 PE=3 SV=1 13 718 0.0E+00
sp|Q9Y7C2|CATB_AJECA Catalase B OS=Ajellomyces capsulatus GN=CATB PE=2 SV=1 6 718 0.0E+00
sp|P55303|CATR_ASPNG Catalase R OS=Aspergillus niger GN=catR PE=3 SV=1 14 718 0.0E+00
sp|P21179|CATE_ECOLI Catalase HPII OS=Escherichia coli (strain K12) GN=katE PE=1 SV=1 41 721 0.0E+00
sp|Q9I1W8|CATE_PSEAE Catalase HPII OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=katE PE=3 SV=1 59 706 0.0E+00
sp|P42234|CATE_BACSU Catalase-2 OS=Bacillus subtilis (strain 168) GN=katE PE=3 SV=2 53 714 0.0E+00
sp|P95539|CATE_PSEPU Catalase HPII OS=Pseudomonas putida GN=katE PE=3 SV=1 59 698 0.0E+00
sp|P50979|CATE_MYCAV Catalase HPII OS=Mycobacterium avium GN=katE PE=3 SV=1 57 683 0.0E+00
sp|P30266|CATE_BACPE Catalase OS=Bacillus pseudofirmus (strain OF4) GN=katE PE=3 SV=3 52 714 0.0E+00
sp|Q55DH8|CATB_DICDI Catalase-B OS=Dictyostelium discoideum GN=catB PE=1 SV=1 69 542 0.0E+00
sp|Q9X576|CATE_RHIME Catalase C OS=Rhizobium meliloti (strain 1021) GN=katE PE=2 SV=2 42 683 1.0E-175
sp|Q9C168|CAT1_NEUCR Catalase-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cat-1 PE=1 SV=2 79 700 8.0E-153
sp|P78574|CATA_ASPFU Catalase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=catA PE=3 SV=2 79 561 2.0E-150
sp|P55305|CATA_EMENI Catalase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=catA PE=2 SV=2 79 563 3.0E-146
sp|P77872|CATA_HELPY Catalase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=katA PE=1 SV=2 64 540 1.0E-116
sp|Q9ZKX5|CATA_HELPJ Catalase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=katA PE=3 SV=1 64 540 4.0E-116
sp|Q8Y3P9|CATA_LISMO Catalase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kat PE=3 SV=1 59 543 1.0E-115
sp|Q926X0|CATA_LISIN Catalase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kat PE=3 SV=1 59 543 3.0E-114
sp|P49316|CATA2_NICPL Catalase isozyme 2 OS=Nicotiana plumbaginifolia GN=CAT2 PE=2 SV=1 58 445 3.0E-113
sp|P55312|CATA2_SOLTU Catalase isozyme 2 OS=Solanum tuberosum GN=CAT2 PE=3 SV=1 58 451 5.0E-113
sp|P55311|CATA_SOLME Catalase OS=Solanum melongena PE=2 SV=1 58 451 7.0E-113
sp|P30264|CATA1_SOLLC Catalase isozyme 1 OS=Solanum lycopersicum GN=CAT1 PE=2 SV=1 58 451 1.0E-112
sp|P49319|CATA1_TOBAC Catalase isozyme 1 OS=Nicotiana tabacum GN=CAT-1 PE=1 SV=2 58 445 2.0E-112
sp|P0A323|CATA_BORPE Catalase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=katA PE=1 SV=1 59 542 3.0E-112
sp|P0A325|CATA_BORPA Catalase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=katA PE=3 SV=1 59 542 3.0E-112
sp|P0A324|CATA_BORBR Catalase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=katA PE=3 SV=1 59 542 3.0E-112
sp|Q27710|CATA_ONCVE Catalase OS=Onchocerca volvulus endobacterium GN=cat PE=2 SV=1 59 542 7.0E-112
sp|P55308|CATA2_HORVU Catalase isozyme 2 OS=Hordeum vulgare GN=CAT2 PE=2 SV=1 61 542 8.0E-112
sp|P25819|CATA2_ARATH Catalase-2 OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=3 58 542 2.0E-111
sp|O97492|CATA_CANLF Catalase OS=Canis lupus familiaris GN=CAT PE=1 SV=3 59 540 2.0E-111
sp|Q9M5L6|CATA_CAPAN Catalase OS=Capsicum annuum GN=CAT PE=2 SV=1 58 451 3.0E-111
sp|O93662|CATA_METBF Catalase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=kat PE=3 SV=1 54 543 5.0E-111
sp|P26901|CATA_BACSU Vegetative catalase OS=Bacillus subtilis (strain 168) GN=katA PE=1 SV=5 59 542 8.0E-111
sp|A2YH64|CATA2_ORYSI Catalase isozyme B OS=Oryza sativa subsp. indica GN=CATB PE=2 SV=2 58 445 1.0E-110
sp|Q0D9C4|CATA2_ORYSJ Catalase isozyme B OS=Oryza sativa subsp. japonica GN=CATB PE=2 SV=1 58 445 1.0E-110
sp|P24168|CATA_LISSE Catalase OS=Listeria seeligeri GN=kat PE=3 SV=1 59 543 1.0E-110
sp|P07145|CATA_IPOBA Catalase OS=Ipomoea batatas PE=2 SV=1 58 542 2.0E-110
sp|Q2I6W4|CATA_CALJA Catalase OS=Callithrix jacchus GN=CAT PE=2 SV=3 35 540 6.0E-110
sp|P42321|CATA_PROMI Catalase OS=Proteus mirabilis GN=katA PE=1 SV=1 55 540 8.0E-110
sp|P49284|CATA1_SOLTU Catalase isozyme 1 OS=Solanum tuberosum GN=CAT1 PE=2 SV=1 58 451 1.0E-109
sp|P45737|CATA_BACFR Catalase OS=Bacteroides fragilis (strain YCH46) GN=katA PE=1 SV=1 64 543 5.0E-109
sp|Q43206|CATA1_WHEAT Catalase-1 OS=Triticum aestivum GN=CAT1 PE=2 SV=1 60 541 6.0E-109
sp|Q42547|CATA3_ARATH Catalase-3 OS=Arabidopsis thaliana GN=CAT3 PE=1 SV=3 58 445 9.0E-109
sp|P29756|CATA1_SOYBN Catalase-1/2 OS=Glycine max GN=CAT1 PE=2 SV=1 58 442 1.0E-108
sp|P45739|CATA_HELAN Catalase OS=Helianthus annuus PE=2 SV=1 58 542 2.0E-108
sp|O52762|CATA_PSEAE Catalase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=katA PE=1 SV=1 54 542 2.0E-108
sp|P55313|CATA2_WHEAT Catalase OS=Triticum aestivum GN=CATA PE=2 SV=1 55 455 2.0E-108
sp|Q9AXH0|CATA_AVIMR Catalase OS=Avicennia marina PE=2 SV=1 61 445 3.0E-108
sp|Q01297|CATA1_RICCO Catalase isozyme 1 OS=Ricinus communis GN=CAT1 PE=2 SV=2 58 542 3.0E-108
sp|O48560|CATA3_SOYBN Catalase-3 OS=Glycine max GN=CAT3 PE=2 SV=1 58 442 3.0E-108
sp|P55307|CATA1_HORVU Catalase isozyme 1 OS=Hordeum vulgare GN=CAT1 PE=2 SV=1 55 470 3.0E-108
sp|P30567|CATA2_GOSHI Catalase isozyme 2 OS=Gossypium hirsutum GN=CAT2 PE=2 SV=1 58 442 4.0E-108
sp|P49315|CATA1_NICPL Catalase isozyme 1 (Fragment) OS=Nicotiana plumbaginifolia GN=CAT1 PE=2 SV=1 58 489 4.0E-108
sp|Q9KRQ1|CATA_VIBCH Catalase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_1585 PE=3 SV=2 46 427 4.0E-108
sp|P17598|CATA1_GOSHI Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 PE=2 SV=2 58 442 6.0E-108
sp|P90682|CATA_ASCSU Catalase OS=Ascaris suum GN=CAT PE=2 SV=2 59 540 7.0E-108
sp|Q59714|CATA_PSEPU Catalase OS=Pseudomonas putida GN=katA PE=3 SV=1 58 543 7.0E-108
sp|O62839|CATA_PIG Catalase OS=Sus scrofa GN=CAT PE=1 SV=4 40 540 8.0E-108
sp|P18122|CATA1_MAIZE Catalase isozyme 1 OS=Zea mays GN=CAT1 PE=2 SV=1 55 456 8.0E-108
sp|Q0E4K1|CATA1_ORYSJ Catalase isozyme A OS=Oryza sativa subsp. japonica GN=CATA PE=2 SV=1 61 442 1.0E-107
sp|P0C549|CATA1_ORYSI Catalase isozyme A OS=Oryza sativa subsp. indica PE=2 SV=1 61 442 1.0E-107
sp|Q7MFM6|CATA_VIBVY Catalase OS=Vibrio vulnificus (strain YJ016) GN=VVA0294 PE=3 SV=1 59 426 1.0E-107
sp|Q9ZN99|CATA_DESVM Catalase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=katA PE=3 SV=2 55 542 1.0E-107
sp|Q96528|CATA1_ARATH Catalase-1 OS=Arabidopsis thaliana GN=CAT1 PE=2 SV=3 58 445 1.0E-107
sp|P00432|CATA_BOVIN Catalase OS=Bos taurus GN=CAT PE=1 SV=3 59 540 2.0E-107
sp|O48561|CATA4_SOYBN Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1 58 442 2.0E-107
sp|P04762|CATA_RAT Catalase OS=Rattus norvegicus GN=Cat PE=1 SV=3 59 540 4.0E-107
sp|Q8D452|CATA_VIBVU Catalase OS=Vibrio vulnificus (strain CMCP6) GN=VV2_1473 PE=3 SV=2 59 426 4.0E-107
sp|Q64405|CATA_CAVPO Catalase OS=Cavia porcellus GN=CAT PE=2 SV=4 35 540 5.0E-107
sp|P33569|BCA_STRVP Bromoperoxidase-catalase OS=Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745) GN=bca PE=1 SV=1 55 456 9.0E-107
sp|O68146|CATA_VIBF1 Catalase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=katA PE=2 SV=1 59 543 1.0E-106
sp|Q9PWF7|CATA_RUGRU Catalase OS=Rugosa rugosa GN=cat PE=2 SV=3 59 540 2.0E-106
sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 58 445 2.0E-106
sp|Q9EV50|CATA_STAXY Catalase A OS=Staphylococcus xylosus GN=katA PE=3 SV=1 64 543 3.0E-106
sp|P30265|CATA_LACSK Catalase OS=Lactobacillus sakei GN=katA PE=3 SV=2 59 542 4.0E-106
sp|P24270|CATA_MOUSE Catalase OS=Mus musculus GN=Cat PE=1 SV=4 59 540 5.0E-106
sp|P49317|CATA3_NICPL Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN=CAT3 PE=2 SV=1 58 445 5.0E-106
sp|P32290|CATA_VIGRR Catalase OS=Vigna radiata var. radiata PE=2 SV=1 58 442 5.0E-106
sp|Q27487|CATA1_CAEEL Peroxisomal catalase 1 OS=Caenorhabditis elegans GN=ctl-2 PE=2 SV=3 59 447 1.0E-105
sp|Q9XHH3|CATA2_SOLLC Catalase isozyme 2 OS=Solanum lycopersicum GN=CAT2 PE=2 SV=1 58 542 2.0E-105
sp|Q5RF10|CATA_PONAB Catalase OS=Pongo abelii GN=CAT PE=2 SV=3 35 540 2.0E-105
sp|P04040|CATA_HUMAN Catalase OS=Homo sapiens GN=CAT PE=1 SV=3 35 540 3.0E-105
sp|P25890|CATA_PEA Catalase OS=Pisum sativum PE=2 SV=1 58 442 6.0E-105
sp|P49318|CATA2_RICCO Catalase isozyme 2 OS=Ricinus communis GN=CAT2 PE=2 SV=1 58 431 8.0E-105
sp|Q59296|CATA_CAMJE Catalase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=katA PE=3 SV=1 59 540 8.0E-105
sp|Q87JE8|CATA_VIBPA Catalase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0305 PE=3 SV=2 59 426 1.0E-104
sp|P48352|CATA3_CUCPE Catalase isozyme 3 OS=Cucurbita pepo GN=CAT3 PE=2 SV=1 58 458 3.0E-104
sp|P48350|CATA1_CUCPE Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 SV=1 58 445 4.0E-104
sp|P18123|CATA3_MAIZE Catalase isozyme 3 OS=Zea mays GN=CAT3 PE=2 SV=2 61 442 6.0E-104
sp|Q9XZD5|CATA_TOXGO Peroxisomal catalase OS=Toxoplasma gondii PE=2 SV=1 59 549 3.0E-103
sp|O61235|CATA2_CAEEL Catalase-2 OS=Caenorhabditis elegans GN=ctl-1 PE=2 SV=3 59 540 1.0E-102
sp|P44390|CATA_HAEIN Catalase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=katA PE=2 SV=1 45 542 1.0E-102
sp|P30263|CATA_PICAN Peroxisomal catalase OS=Pichia angusta GN=PXP9 PE=1 SV=1 75 547 2.0E-102
sp|P94377|CATX_BACSU Catalase X OS=Bacillus subtilis (strain 168) GN=katX PE=3 SV=1 50 540 2.0E-102
sp|Q59337|CATA_DEIRA Catalase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=katA PE=1 SV=2 59 428 4.0E-102
sp|Q9PT92|CATA_DANRE Catalase OS=Danio rerio GN=cat PE=2 SV=1 59 540 1.0E-101
sp|P55310|CATA_SECCE Catalase OS=Secale cereale PE=2 SV=1 61 458 2.0E-101
sp|P48351|CATA2_CUCPE Catalase isozyme 2 OS=Cucurbita pepo GN=CAT2 PE=2 SV=1 58 458 3.0E-101
sp|Q66V81|CATB_STAXY Catalase B OS=Staphylococcus xylosus GN=katB PE=3 SV=2 64 543 8.0E-101
sp|Q59635|CATB_PSEAE Catalase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=katB PE=3 SV=1 59 445 1.0E-100
sp|P46206|CATB_PSESY Catalase OS=Pseudomonas syringae pv. syringae GN=katB PE=1 SV=2 59 444 5.0E-100
sp|Q49XC1|CATA_STAS1 Catalase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=katA PE=3 SV=1 64 543 6.0E-100
sp|Q9Z598|CATA_STRCO Catalase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=katA PE=3 SV=1 55 540 2.0E-99
sp|P0A326|CATA_BRUME Catalase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=katA PE=3 SV=2 56 506 2.0E-99
sp|P0A327|CATA_BRUAB Catalase OS=Brucella abortus biovar 1 (strain 9-941) GN=katA PE=1 SV=2 56 506 2.0E-99
sp|P55306|CATA_SCHPO Catalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta1 PE=1 SV=1 61 549 4.0E-99
sp|Q8FWU0|CATA_BRUSU Catalase OS=Brucella suis biovar 1 (strain 1330) GN=katA PE=3 SV=3 56 506 6.0E-98
sp|P12365|CATA2_MAIZE Catalase isozyme 2 OS=Zea mays GN=CAT2 PE=2 SV=3 58 442 8.0E-97
sp|Q9KW19|CATA_STAWA Catalase OS=Staphylococcus warneri GN=katA PE=3 SV=1 64 548 3.0E-96
sp|P17336|CATA_DROME Catalase OS=Drosophila melanogaster GN=Cat PE=1 SV=2 55 445 9.0E-96
sp|O77229|CATA_DICDI Catalase-A OS=Dictyostelium discoideum GN=catA PE=2 SV=2 59 544 1.0E-95
sp|Q8NWV5|CATA_STAAW Catalase OS=Staphylococcus aureus (strain MW2) GN=katA PE=3 SV=1 64 548 3.0E-95
sp|Q6G9M4|CATA_STAAS Catalase OS=Staphylococcus aureus (strain MSSA476) GN=katA PE=3 SV=1 64 548 3.0E-95
sp|Q7A5T2|CATA_STAAN Catalase OS=Staphylococcus aureus (strain N315) GN=katA PE=1 SV=2 64 548 3.0E-95
sp|Q99UE2|CATA_STAAM Catalase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=katA PE=3 SV=2 64 548 3.0E-95
sp|Q5HG86|CATA_STAAC Catalase OS=Staphylococcus aureus (strain COL) GN=katA PE=3 SV=2 64 548 3.0E-95
sp|Q2YXT2|CATA_STAAB Catalase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=katA PE=3 SV=2 64 548 3.0E-95
sp|Q2FYU7|CATA_STAA8 Catalase OS=Staphylococcus aureus (strain NCTC 8325) GN=katA PE=2 SV=2 64 548 3.0E-95
sp|Q2FH99|CATA_STAA3 Catalase OS=Staphylococcus aureus (strain USA300) GN=katA PE=3 SV=1 64 548 3.0E-95
sp|Q9L4S1|CATA_STAAU Catalase OS=Staphylococcus aureus GN=katA PE=3 SV=1 64 548 3.0E-95
sp|Q96VB8|CATA_CANBO Peroxisomal catalase OS=Candida boidinii GN=CTA1 PE=3 SV=1 61 535 1.0E-94
sp|P07820|CATA_CANTR Peroxisomal catalase OS=Candida tropicalis GN=POX9 PE=1 SV=4 58 540 4.0E-94
sp|Q6GH72|CATA_STAAR Catalase OS=Staphylococcus aureus (strain MRSA252) GN=katA PE=3 SV=1 64 548 5.0E-94
sp|Q59602|CATA_NEIGO Catalase OS=Neisseria gonorrhoeae GN=katA PE=3 SV=1 59 547 6.0E-94
sp|P95631|CATA_RHIME Catalase A OS=Rhizobium meliloti (strain 1021) GN=katA PE=3 SV=2 59 540 1.0E-93
sp|O13289|CATA_CANAL Peroxisomal catalase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CTA1 PE=2 SV=4 58 536 1.0E-93
sp|Q4L643|CATA_STAHJ Catalase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=katA PE=3 SV=1 64 431 2.0E-93
sp|Q9L4S2|CATB_STAAA Catalase-like protein OS=Staphylococcus aureus subsp. anaerobius GN=katB PE=3 SV=1 64 443 3.0E-93
sp|Q8CPD0|CATA_STAES Catalase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=katA PE=3 SV=1 64 443 4.0E-93
sp|Q5HPK8|CATA_STAEQ Catalase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=katA PE=3 SV=1 64 443 4.0E-93
sp|Q2PUJ9|CATA_STAEP Catalase OS=Staphylococcus epidermidis GN=katA PE=3 SV=1 64 443 6.0E-93
sp|P81138|CAT1_PENJA Catalase OS=Penicillium janthinellum PE=1 SV=1 72 431 5.0E-91
sp|P29422|CATA_MICLU Catalase OS=Micrococcus luteus GN=katA PE=1 SV=2 57 475 2.0E-85
sp|P15202|CATA_YEAST Peroxisomal catalase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTA1 PE=1 SV=1 44 415 1.0E-80
sp|P55304|CATA_BOTFU Catalase A OS=Botryotinia fuckeliana GN=catA PE=2 SV=1 59 498 1.0E-78
sp|P06115|CATT_YEAST Catalase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTT1 PE=1 SV=3 66 542 1.0E-67
sp|A6ZV70|CATT_YEAS7 Catalase T OS=Saccharomyces cerevisiae (strain YJM789) GN=CTT1 PE=3 SV=2 66 542 2.0E-67
sp|P11934|CATA_PENJA Catalase OS=Penicillium janthinellum PE=1 SV=1 53 427 7.0E-37
sp|Q55025|SRPA_SYNE7 Catalase-related peroxidase OS=Synechococcus elongatus (strain PCC 7942) GN=srpA PE=1 SV=2 102 403 4.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0004096 catalase activity Yes
GO:0020037 heme binding Yes
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003674 molecular_function No
GO:0046906 tetrapyrrole binding No
GO:0004601 peroxidase activity No
GO:0016209 antioxidant activity No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 39.72 21.72 57.72
CcL In ants, during behavior modification 494.74 174.23 815.24
CcD In ants, recently dead 1692.14 226.62 3157.65

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.002236 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3736
MRCHGLTAVAVALAWAGFVRSECPLAGSGHVVARADSGSDPGSRSHIAKSDVDDSKGFMNTDGGGPIADQQSLKA
GPRGSTLLEDFIFRRKITHFDHERIPERAVHARGAGAYGTFTSYGSFSNITAADFLSTEGKKTNVFVRFSTVAGS
RGSADTARDVHGFATRFYTDEGNFDLVGNNIPVFFIQDAIQFPDLIHAVKPNMKVEIPTAATAHDEAWDFFSQQP
STLHTLMWAMAGYGIPRSYRHMDGFGVHTFRLVNDKGESKLVKWVWKSMQGKASLVWEEAQHISGNDADYHRRDL
TEAIDAGNFPEWELNVQVIDEDQALAFGFDVLDATKIIPEELAPLQKLGKMQLNANPVNYFSETEQVMYQVGNIV
RGIDFTEDPLLQGRIFSYLDTQLNRAMGSPNFEQIPINRPVNPVSNNNRDGALQMLIHKNTAAYTPNTLNNGFPA
QANQTVGKGFFTAPDREARGPLTRELSETFSDHWSQPRLFLNSISPEEMQMVVNAIRFETSQVQPAVQKQVLTQL
NRVSNDLAKRVATALGMDAPAPDPKFYHNNRTQGLSIFGVKLPTIAAFKVGVLTSTDAPGSLDQAKALREALKSD
KVVVETVGEMLADGVNVTYSAAAATAFDAIVVADGAETLFNEDKQSTLFPPGRPMSIVSDGYRWGKPIGFLGGAQ
EAAKAAGVKGGAGVYQAPDVQALAKDLADGLATFKFTDRFPMDGKMNNSSATR
Coding >Ophio5|3736
ATGCGTTGCCACGGACTCACTGCCGTTGCCGTTGCTCTGGCCTGGGCTGGCTTCGTTCGCTCTGAATGCCCCCTG
GCTGGTTCCGGCCATGTCGTCGCCAGGGCCGACTCTGGCTCGGATCCTGGCTCTCGTTCCCACATTGCCAAGTCC
GATGTTGACGACAGCAAGGGCTTCATGAACACCGATGGCGGTGGCCCTATAGCCGACCAGCAGAGCCTCAAGGCT
GGCCCCCGCGGCTCTACCCTGCTTGAGGATTTCATCTTCCGTCGCAAAATCACCCACTTCGACCATGAGCGGATT
CCGGAGCGAGCCGTCCACGCCCGTGGAGCTGGTGCCTATGGTACTTTCACCAGTTACGGCTCTTTCAGCAACATC
ACCGCTGCCGACTTTTTGAGCACCGAGGGCAAGAAGACAAACGTCTTCGTCCGCTTCTCCACCGTCGCTGGCTCC
CGCGGCTCTGCCGACACTGCCCGGGACGTCCACGGCTTTGCCACGCGTTTTTACACCGACGAGGGTAACTTTGAC
CTGGTGGGAAACAATATTCCTGTCTTCTTTATCCAGGATGCCATCCAGTTTCCGGACCTCATCCATGCTGTCAAG
CCCAACATGAAGGTCGAGATCCCCACTGCTGCGACGGCCCATGATGAGGCGTGGGATTTTTTCAGTCAGCAGCCC
AGCACCCTTCACACCCTGATGTGGGCCATGGCAGGCTACGGCATTCCACGCAGTTATCGCCACATGGACGGCTTT
GGCGTCCACACTTTCCGTCTTGTCAATGACAAGGGCGAGTCAAAACTCGTCAAGTGGGTGTGGAAGTCGATGCAA
GGAAAGGCGAGTCTGGTGTGGGAAGAGGCACAGCACATCTCGGGCAACGACGCCGACTACCACCGGAGAGACCTG
ACCGAAGCCATCGATGCTGGCAACTTCCCCGAGTGGGAGCTCAATGTGCAGGTCATCGACGAGGACCAGGCTCTC
GCCTTTGGCTTCGATGTTCTCGACGCGACCAAAATCATCCCCGAGGAGCTTGCGCCGCTCCAGAAGTTGGGCAAG
ATGCAACTCAATGCCAATCCCGTCAACTACTTCAGCGAGACGGAGCAGGTCATGTACCAGGTCGGCAACATCGTC
AGGGGCATCGACTTCACCGAGGACCCTCTCCTCCAGGGGCGCATCTTCTCCTACCTCGACACTCAGCTCAACCGA
GCCATGGGTAGCCCCAACTTTGAGCAGATCCCCATCAACCGGCCTGTCAACCCCGTGTCCAACAACAACCGAGAC
GGCGCCTTGCAAATGCTAATTCACAAGAACACGGCGGCCTATACCCCGAATACGCTCAACAACGGCTTTCCGGCG
CAGGCCAACCAGACCGTCGGCAAGGGCTTCTTCACCGCGCCCGATCGAGAGGCCAGAGGCCCTCTCACGCGCGAG
TTGAGCGAGACATTTTCGGACCATTGGAGCCAGCCTCGACTCTTCCTCAACTCCATCAGTCCCGAAGAAATGCAA
ATGGTGGTCAATGCCATTCGCTTCGAGACGAGCCAGGTCCAGCCTGCGGTGCAGAAGCAGGTGCTGACGCAACTC
AATCGCGTCAGCAACGACCTGGCCAAGCGTGTCGCGACGGCCTTGGGCATGGATGCGCCGGCGCCCGACCCCAAG
TTCTACCACAACAACCGTACGCAGGGTCTGAGCATCTTTGGCGTGAAGCTGCCCACGATCGCCGCCTTCAAGGTT
GGCGTGCTCACCTCCACGGACGCCCCGGGCTCGCTGGACCAGGCCAAGGCGCTCCGGGAGGCTCTCAAGTCGGAC
AAGGTGGTGGTGGAGACGGTGGGCGAAATGCTCGCCGACGGCGTGAATGTGACGTACTCGGCGGCGGCGGCTACG
GCATTTGACGCCATCGTCGTGGCGGATGGCGCCGAGACGCTGTTCAACGAGGACAAACAGTCGACGCTGTTCCCC
CCAGGCCGACCCATGTCCATCGTTTCAGACGGATACCGCTGGGGGAAGCCGATTGGCTTCCTCGGCGGCGCGCAG
GAGGCGGCCAAGGCGGCGGGCGTCAAGGGTGGCGCCGGCGTCTACCAGGCCCCCGACGTGCAGGCTCTGGCCAAG
GACCTTGCCGACGGTCTGGCCACATTCAAGTTTACCGACCGCTTCCCGATGGACGGCAAGATGAACAACAGTTCC
GCGACGAGG
Transcript >Ophio5|3736
ATGCGTTGCCACGGACTCACTGCCGTTGCCGTTGCTCTGGCCTGGGCTGGCTTCGTTCGCTCTGAATGCCCCCTG
GCTGGTTCCGGCCATGTCGTCGCCAGGGCCGACTCTGGCTCGGATCCTGGCTCTCGTTCCCACATTGCCAAGTCC
GATGTTGACGACAGCAAGGGCTTCATGAACACCGATGGCGGTGGCCCTATAGCCGACCAGCAGAGCCTCAAGGCT
GGCCCCCGCGGCTCTACCCTGCTTGAGGATTTCATCTTCCGTCGCAAAATCACCCACTTCGACCATGAGCGGATT
CCGGAGCGAGCCGTCCACGCCCGTGGAGCTGGTGCCTATGGTACTTTCACCAGTTACGGCTCTTTCAGCAACATC
ACCGCTGCCGACTTTTTGAGCACCGAGGGCAAGAAGACAAACGTCTTCGTCCGCTTCTCCACCGTCGCTGGCTCC
CGCGGCTCTGCCGACACTGCCCGGGACGTCCACGGCTTTGCCACGCGTTTTTACACCGACGAGGGTAACTTTGAC
CTGGTGGGAAACAATATTCCTGTCTTCTTTATCCAGGATGCCATCCAGTTTCCGGACCTCATCCATGCTGTCAAG
CCCAACATGAAGGTCGAGATCCCCACTGCTGCGACGGCCCATGATGAGGCGTGGGATTTTTTCAGTCAGCAGCCC
AGCACCCTTCACACCCTGATGTGGGCCATGGCAGGCTACGGCATTCCACGCAGTTATCGCCACATGGACGGCTTT
GGCGTCCACACTTTCCGTCTTGTCAATGACAAGGGCGAGTCAAAACTCGTCAAGTGGGTGTGGAAGTCGATGCAA
GGAAAGGCGAGTCTGGTGTGGGAAGAGGCACAGCACATCTCGGGCAACGACGCCGACTACCACCGGAGAGACCTG
ACCGAAGCCATCGATGCTGGCAACTTCCCCGAGTGGGAGCTCAATGTGCAGGTCATCGACGAGGACCAGGCTCTC
GCCTTTGGCTTCGATGTTCTCGACGCGACCAAAATCATCCCCGAGGAGCTTGCGCCGCTCCAGAAGTTGGGCAAG
ATGCAACTCAATGCCAATCCCGTCAACTACTTCAGCGAGACGGAGCAGGTCATGTACCAGGTCGGCAACATCGTC
AGGGGCATCGACTTCACCGAGGACCCTCTCCTCCAGGGGCGCATCTTCTCCTACCTCGACACTCAGCTCAACCGA
GCCATGGGTAGCCCCAACTTTGAGCAGATCCCCATCAACCGGCCTGTCAACCCCGTGTCCAACAACAACCGAGAC
GGCGCCTTGCAAATGCTAATTCACAAGAACACGGCGGCCTATACCCCGAATACGCTCAACAACGGCTTTCCGGCG
CAGGCCAACCAGACCGTCGGCAAGGGCTTCTTCACCGCGCCCGATCGAGAGGCCAGAGGCCCTCTCACGCGCGAG
TTGAGCGAGACATTTTCGGACCATTGGAGCCAGCCTCGACTCTTCCTCAACTCCATCAGTCCCGAAGAAATGCAA
ATGGTGGTCAATGCCATTCGCTTCGAGACGAGCCAGGTCCAGCCTGCGGTGCAGAAGCAGGTGCTGACGCAACTC
AATCGCGTCAGCAACGACCTGGCCAAGCGTGTCGCGACGGCCTTGGGCATGGATGCGCCGGCGCCCGACCCCAAG
TTCTACCACAACAACCGTACGCAGGGTCTGAGCATCTTTGGCGTGAAGCTGCCCACGATCGCCGCCTTCAAGGTT
GGCGTGCTCACCTCCACGGACGCCCCGGGCTCGCTGGACCAGGCCAAGGCGCTCCGGGAGGCTCTCAAGTCGGAC
AAGGTGGTGGTGGAGACGGTGGGCGAAATGCTCGCCGACGGCGTGAATGTGACGTACTCGGCGGCGGCGGCTACG
GCATTTGACGCCATCGTCGTGGCGGATGGCGCCGAGACGCTGTTCAACGAGGACAAACAGTCGACGCTGTTCCCC
CCAGGCCGACCCATGTCCATCGTTTCAGACGGATACCGCTGGGGGAAGCCGATTGGCTTCCTCGGCGGCGCGCAG
GAGGCGGCCAAGGCGGCGGGCGTCAAGGGTGGCGCCGGCGTCTACCAGGCCCCCGACGTGCAGGCTCTGGCCAAG
GACCTTGCCGACGGTCTGGCCACATTCAAGTTTACCGACCGCTTCCCGATGGACGGCAAGATGAACAACAGTTCC
GCGACGAGGTAG
Gene >Ophio5|3736
ATGCGTTGCCACGGACTCACTGCCGTTGCCGTTGCTCTGGCCTGGGCTGGCTTCGTTCGCTCTGAATGCCCCCTG
GCTGGTTCCGGCCATGTCGTCGCCAGGGCCGACTCTGGCTCGGATCCTGGCTCTCGTTCCCACATTGCCAAGTCC
GATGTTGACGACAGCAAGGGCTTCATGAACACCGATGGCGGTGGCCCTATAGCCGACCAGCAGAGCCTCAAGGCT
GGCCCCCGCGGCTCTACCCTGCTTGAGGATTTCATCTTCCGTCGCAAAATCACCCACTTCGACCATGAGCGGGTG
AGCCCATCCACTTCCTGCTTCTACCGCTTGTTGCTGACGCTCCCAAGATTCCGGAGCGAGCCGTCCACGCCCGTG
GAGCTGGTGCCTATGGTACTTTCACCAGTTACGGCTCTTTCAGCAACATCACCGCTGCCGACTTTTTGAGCACCG
AGGGCAAGAAGACAAACGTCTTCGTCCGCTTCTCCACCGTCGCTGGCTCCCGCGGCTCTGCCGACACTGCCCGGG
ACGTCCACGGCTTTGCCACGCGTTTTTACACCGACGAGGGTAACTTTGACCTGGTGGGAAACAATATTCCTGTCT
TCTTTATCCAGGATGCCATCCAGTTTCCGGACCTCATCCATGCTGTCAAGCCCAACATGAAGGTCGAGATCCCCA
CTGCTGCGACGGCCCATGATGAGGCGTGGGATTTTTTCAGTCAGCAGCCCAGCACCCTTCACACCCTGATGTGGG
CCATGGCAGGCTACGGCATTCCACGCAGTTATCGCCACATGGTATGTCCCTCTTCTCGACCCACGTGGCAAAAAG
ACTGACATGGCCTAGGACGGCTTTGGCGTCCACACTTTCCGTCTTGTCAATGACAAGGGCGAGTCAAAACTCGTC
AAGTGGGTGTGGAAGTCGATGCAAGGAAAGGCGAGTCTGGTGTGGGAAGAGGCACAGCACATCTCGGGCAACGAC
GCCGACTACCACCGGAGAGACCTGACCGAAGCCATCGATGCTGGCAACTTCCCCGAGTGGGAGCTCAATGTGCAG
GTCATCGACGAGGACCAGGCTCTCGCCTTTGGCTTCGATGTTCTCGACGCGACCAAAATCATCCCCGAGGAGCTT
GCGCCGCTCCAGAAGTTGGGCAAGATGCAACTCAATGCCAATCCCGTCAACTACTTCAGCGAGACGGAGCAGGTC
ATGTACCAGGTCGGCAACATCGTCAGGGGCATCGACTTCACCGAGGACCCTCTCCTCCAGGGGCGCATCTTCTCC
TACCTCGACACTCAGCTCAACCGAGCCATGGGTAGCCCCAACTTTGAGCAGATCCCCATCAACCGGCCTGTCAAC
CCCGTGTCCAACAACAACCGAGACGGCGCCTTGCAAATGCTAATTCACAAGAACACGGCGGCCTATACCCCGAAT
ACGCTCAACAACGGCTTTCCGGCGCAGGCCAACCAGACCGTCGGCAAGGGCTTCTTCACCGCGCCCGATCGAGAG
GCCAGAGGCCCTCTCACGCGCGAGTTGAGCGAGACATTTTCGGACCATTGGAGCCAGCCTCGACTCTTCCTCAAC
TCCATCAGTCCCGAAGAAATGCAAATGGTGGTCAATGCCATTCGCTTCGAGACGAGCCAGGTCCAGCCTGCGGTG
CAGAAGCAGGTGCTGACGCAACTCAATCGCGTCAGCAACGACCTGGCCAAGCGTGTCGCGACGGCCTTGGGCATG
GATGCGCCGGCGCCCGACCCCAAGTTCTACCACAACAACCGTACGCAGGGTCTGAGCATCTTTGGCGTGAAGCTG
CCCACGATCGCCGCCTTCAAGGTTGGCGTGCTCACCTCCACGGACGCCCCGGGCTCGCTGGACCAGGCCAAGGCG
CTCCGGGAGGCTCTCAAGTCGGACAAGGTGGTGGTGGAGACGGTGGGCGAAATGCTCGCCGACGGCGTGAATGTG
ACGTACTCGGCGGCGGCGGCTACGGCATTTGACGCCATCGTCGTGGCGGATGGCGCCGAGACGCTGTTCAACGAG
GACAAACAGTCGACGCTGTTCCCCCCAGGCCGACCCATGTCCATCGTTTCAGACGGATACCGCTGGGGGAAGCCG
ATTGGCTTCCTCGGCGGCGCGCAGGAGGCGGCCAAGGCGGCGGGCGTCAAGGGTGGCGCCGGCGTCTACCAGGCC
CCCGACGTGCAGGCTCTGGCCAAGGACCTTGCCGACGGTCTGGCCACATTCAAGTTTACCGACCGCTTCCCGATG
GACGGCAAGATGAACAACAGTTCCGCGACGAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail