Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3735
Gene name
Locationscaffold_294:22678..24525
Strand+
Gene length (bp)1847
Transcript length (bp)1494
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05577 Peptidase_S28 Serine carboxypeptidase S28 1.3E-25 35 436

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBU7|PCP_PONAB Lysosomal Pro-X carboxypeptidase OS=Pongo abelii GN=PRCP PE=2 SV=1 29 435 6.0E-14
sp|P42785|PCP_HUMAN Lysosomal Pro-X carboxypeptidase OS=Homo sapiens GN=PRCP PE=1 SV=1 29 435 2.0E-13
sp|Q2TA14|PCP_BOVIN Lysosomal Pro-X carboxypeptidase OS=Bos taurus GN=PRCP PE=2 SV=1 41 434 4.0E-13
sp|Q7TMR0|PCP_MOUSE Lysosomal Pro-X carboxypeptidase OS=Mus musculus GN=Prcp PE=1 SV=2 78 435 4.0E-11
sp|D4AYS6|A1345_ARTBC Probable extracellular serine carboxypeptidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01345 PE=1 SV=1 25 188 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBU7|PCP_PONAB Lysosomal Pro-X carboxypeptidase OS=Pongo abelii GN=PRCP PE=2 SV=1 29 435 6.0E-14
sp|P42785|PCP_HUMAN Lysosomal Pro-X carboxypeptidase OS=Homo sapiens GN=PRCP PE=1 SV=1 29 435 2.0E-13
sp|Q2TA14|PCP_BOVIN Lysosomal Pro-X carboxypeptidase OS=Bos taurus GN=PRCP PE=2 SV=1 41 434 4.0E-13
sp|Q7TMR0|PCP_MOUSE Lysosomal Pro-X carboxypeptidase OS=Mus musculus GN=Prcp PE=1 SV=2 78 435 4.0E-11
sp|D4AYS6|A1345_ARTBC Probable extracellular serine carboxypeptidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01345 PE=1 SV=1 25 188 1.0E-09
sp|P34676|PCP5_CAEEL Prolyl carboxy peptidase like protein 5 OS=Caenorhabditis elegans GN=pcp-5 PE=1 SV=1 39 190 2.0E-08
sp|Q9EPB1|DPP2_RAT Dipeptidyl peptidase 2 OS=Rattus norvegicus GN=Dpp7 PE=1 SV=1 84 223 2.0E-08
sp|P34528|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorhabditis elegans GN=K12H4.7 PE=3 SV=2 27 246 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0017171 serine hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 1.75 0.23 3.27
CcL In ants, during behavior modification 8.02 2.39 13.65
CcD In ants, recently dead 2.93 0.63 5.23

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.224879 no
CcL CcD 0.005848 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3735
MIPIPFFLFKNAVCFLVGICQDGHHLISQPVNHSDSEGVQFTQQYATITNYFEDGGPIVVQLTHRSPQLDVEQSL
SRDYARAWRGMAVSIEHRYFGASQPNGFKNRDASFEHLTLENVMADVVRVVQHIRFTTPGCLRSEVIAHGDGYWG
FVAVALRQNYPDIFFAALAIAPPTRSFFLNPRPQDADQFLYRDHVSRVYHRRSSLGAANIRKSFLFLEDQFLERR
DMKRLQSKLNLCTRPHSNDSTHLNQLVEVYANAIIGPAAMVYANTIAVPTALDYAMGWHKYHFGPMNRVVERAAS
FTDPTSDKKAFHVYGNFLRWVDENWYSRRRNACLDWTGLKVFKQKWSDDLSTKSASYIGCTYFPLCTLNANESGI
FLPRTTNCEGLVQNCMEMFEDKAIALTQEEVWTRYKMSPEDLNNSSRILFSVDRSDPMSSLVGGYAPEGINVAWS
SCDHVHRIEHDMIARRTQPDFDQWKAEETHVISRWLMSCTRNITWGR
Coding >Ophio5|3735
ATGATACCGATACCATTCTTCCTTTTCAAGAACGCAGTTTGTTTTTTAGTTGGGATTTGCCAAGATGGTCATCAT
CTCATCTCTCAGCCAGTCAATCACTCCGATAGCGAAGGAGTCCAATTTACACAGCAATATGCCACGATTACGAAC
TATTTCGAGGACGGAGGTCCGATTGTCGTGCAGTTGACCCACCGAAGCCCCCAACTAGATGTGGAACAATCCTTG
AGCCGTGATTACGCCAGAGCGTGGCGAGGCATGGCGGTATCTATCGAGCATCGCTATTTCGGTGCCAGTCAGCCG
AATGGGTTCAAGAACCGTGACGCCTCGTTTGAGCACCTGACTTTGGAAAATGTCATGGCCGACGTCGTACGTGTC
GTCCAGCATATACGATTCACGACGCCAGGCTGTTTACGGAGCGAGGTCATCGCTCATGGCGACGGTTACTGGGGC
TTCGTCGCCGTGGCTTTGCGACAGAACTACCCAGACATCTTCTTTGCCGCCCTTGCCATAGCACCTCCTACTCGA
AGCTTCTTTTTGAACCCGAGGCCGCAGGACGCCGATCAGTTCCTCTACCGAGATCATGTCAGCCGAGTTTATCAT
CGTCGTTCCTCGCTCGGCGCGGCAAACATCAGGAAATCCTTCCTCTTCCTTGAGGATCAGTTTCTAGAGCGTAGG
GACATGAAACGCCTACAGTCCAAGCTAAATCTATGCACAAGGCCTCATTCTAATGATTCGACGCACTTGAATCAG
CTCGTCGAGGTCTACGCAAACGCCATTATCGGCCCTGCTGCCATGGTCTACGCAAACACCATTGCCGTCCCTACT
GCCTTGGACTACGCCATGGGGTGGCACAAATACCATTTCGGTCCAATGAATCGTGTAGTCGAGCGAGCTGCGAGC
TTCACTGACCCTACCTCTGATAAAAAAGCGTTCCATGTATACGGGAATTTCCTCCGCTGGGTCGACGAGAATTGG
TACAGTCGACGCAGGAACGCATGTCTGGACTGGACAGGCCTGAAAGTCTTTAAGCAAAAGTGGTCTGACGACCTG
TCCACCAAGTCGGCGAGCTACATCGGCTGCACTTACTTTCCCCTGTGCACGTTGAACGCCAATGAAAGCGGTATA
TTCCTACCTCGGACAACTAACTGTGAAGGGCTGGTGCAAAATTGCATGGAAATGTTTGAAGACAAAGCCATTGCA
CTCACGCAGGAGGAAGTGTGGACACGGTACAAGATGAGCCCTGAGGACTTGAACAACTCGAGCCGCATTCTCTTC
TCTGTCGACCGGTCGGACCCCATGAGCTCGCTGGTGGGTGGATATGCGCCGGAAGGCATCAATGTGGCATGGTCC
AGTTGCGACCATGTCCATCGCATCGAGCACGATATGATTGCACGCCGGACCCAGCCTGATTTTGATCAGTGGAAA
GCGGAAGAGACACATGTCATTTCGAGGTGGCTGATGAGTTGCACGCGGAACATCACCTGGGGTAGG
Transcript >Ophio5|3735
ATGATACCGATACCATTCTTCCTTTTCAAGAACGCAGTTTGTTTTTTAGTTGGGATTTGCCAAGATGGTCATCAT
CTCATCTCTCAGCCAGTCAATCACTCCGATAGCGAAGGAGTCCAATTTACACAGCAATATGCCACGATTACGAAC
TATTTCGAGGACGGAGGTCCGATTGTCGTGCAGTTGACCCACCGAAGCCCCCAACTAGATGTGGAACAATCCTTG
AGCCGTGATTACGCCAGAGCGTGGCGAGGCATGGCGGTATCTATCGAGCATCGCTATTTCGGTGCCAGTCAGCCG
AATGGGTTCAAGAACCGTGACGCCTCGTTTGAGCACCTGACTTTGGAAAATGTCATGGCCGACGTCGTACGTGTC
GTCCAGCATATACGATTCACGACGCCAGGCTGTTTACGGAGCGAGGTCATCGCTCATGGCGACGGTTACTGGGGC
TTCGTCGCCGTGGCTTTGCGACAGAACTACCCAGACATCTTCTTTGCCGCCCTTGCCATAGCACCTCCTACTCGA
AGCTTCTTTTTGAACCCGAGGCCGCAGGACGCCGATCAGTTCCTCTACCGAGATCATGTCAGCCGAGTTTATCAT
CGTCGTTCCTCGCTCGGCGCGGCAAACATCAGGAAATCCTTCCTCTTCCTTGAGGATCAGTTTCTAGAGCGTAGG
GACATGAAACGCCTACAGTCCAAGCTAAATCTATGCACAAGGCCTCATTCTAATGATTCGACGCACTTGAATCAG
CTCGTCGAGGTCTACGCAAACGCCATTATCGGCCCTGCTGCCATGGTCTACGCAAACACCATTGCCGTCCCTACT
GCCTTGGACTACGCCATGGGGTGGCACAAATACCATTTCGGTCCAATGAATCGTGTAGTCGAGCGAGCTGCGAGC
TTCACTGACCCTACCTCTGATAAAAAAGCGTTCCATGTATACGGGAATTTCCTCCGCTGGGTCGACGAGAATTGG
TACAGTCGACGCAGGAACGCATGTCTGGACTGGACAGGCCTGAAAGTCTTTAAGCAAAAGTGGTCTGACGACCTG
TCCACCAAGTCGGCGAGCTACATCGGCTGCACTTACTTTCCCCTGTGCACGTTGAACGCCAATGAAAGCGGTATA
TTCCTACCTCGGACAACTAACTGTGAAGGGCTGGTGCAAAATTGCATGGAAATGTTTGAAGACAAAGCCATTGCA
CTCACGCAGGAGGAAGTGTGGACACGGTACAAGATGAGCCCTGAGGACTTGAACAACTCGAGCCGCATTCTCTTC
TCTGTCGACCGGTCGGACCCCATGAGCTCGCTGGTGGGTGGATATGCGCCGGAAGGCATCAATGTGGCATGGTCC
AGTTGCGACCATGTCCATCGCATCGAGCACGATATGATTGCACGCCGGACCCAGCCTGATTTTGATCAGTGGAAA
GCGGAAGAGACACATGTCATTTCGAGGTGGCTGATGAGTTGCACGCGGAACATCACCTGGGGTAGGTAG
Gene >Ophio5|3735
ATGATACCGATACCATTCTTCCTTTTCAAGAACGCAGTTTGTTTTTTAGTTGGGATTTGCCAAGATGGTCATCAT
CTCATCTCTCAGCCAGTCAATCACTCCGATAGCGAAGGAGTCCAATTTACACAGCAATATGCCACGATTACGAAC
TATTTCGAGGACGGAGGTCCGATTGTCGTGCAGTTGACCCACCGAAGCCCCCAACTAGATGTGGTATGACACGGA
CGGCTGGACTGACTGACTGACGGACTGGCTGACGGACTGGCCGATGGTAGGAACAATCCTTGAGCCGTGATTACG
CCAGAGCGTGGCGAGGCATGGCGGTATCTATCGAGCATCGCTATTTCGGTGCCAGTCAGCCGAATGGGTTCAAGA
ACCGTGACGCCTCGTTTGAGCACCTGACTTTGGAAAATGTCATGGCCGACGTCGTACGTGTCGTCCAGCATATAC
GATTCACGACGCCAGGCTGTTTACGGAGCGAGGTCATCGCTCATGGCGGTAAGGGAAGCACCTTTTGACACAAAG
CGGCACTGATCTGTCTTGTCTGATGCTAGACGGTTACTGGGGCTTCGTCGCCGTGGCTTTGCGACAGAACTACCC
AGACATCTTCTTTGCCGCCCTTGCCATAGCACCTCCTACTCGAAGCTTCTTTTTGAACCCGAGGCCGCAGGACGC
CGATCAGTTCCTCTACCGAGATCATGTGAGTCCAACGTTTCCGGACGGACAAGGAAAGCAAACTAAGCTGGCGAT
GGCTCCTAGGTCAGCCGAGTTTATCATCGTCGTTCCTCGCTCGGCGCGGCAAACATCAGGAAATCCTTCCTCTTC
CTTGAGGATCAGTTTCTAGAGCGTAGTACGTGACGCCTCCCCCGCCACGTTGCGTGCATTGCTCACCAGCAACCT
GACTAGGGGACATGAAACGCCTACAGTCCAAGCTAAATCTATGCACAAGGCCTCATTCTAATGATTCGACGCACT
TGAATCAGCTCGTCGAGGTCTACGCAAACGCCATTATCGGCCCTGCTGCCATGGTCTACGCAAACACCATTGCCG
TCCCTACTGCCTTGGACTACGCCATGGGGTGGCACAAATACCATTTCGGTCCAATGAATCGTGTAGTCGAGCGAG
CTGCGAGCTTCACTGACCCTACCTCTGATAAAAAAGCGTTCCATGTATACGGGAATTTCCTCCGCTGGGTCGACG
AGAATTGGTACAGTCGACGCAGGAACGCATGTCTGGACTGGACAGGCCTGAAAGTCTTTAAGCAAAAGTGGTCTG
ACGACCTGTCCACCAAGTCGGCGAGCTACATCGGCTGTGAGCTCACCATTATCGTGTCCCGGCGCAAAGAAGTCG
TAACTAATGCGGCGGTGCAGGCACTTACTTTCCCCTGTGCACGTTGAACGCCAATGAAAGCGGTATATTCCTACC
TCGGACAACTAACTGTGAAGGGCTGGTGCAAAATTGCATGGAAATGTTTGAAGACAAAGCCATTGCACTCACGCA
GGAGGAAGTGTGGACACGGTACAAGATGAGCCCTGAGGACTTGAACAACTCGAGCCGCATTCTCTTCTCTGTCGA
CCGGTCGGACCCCATGAGCTCGCTGGTGGGTGGATATGCGCCGGAAGGCATCAATGTGGCATGGTCCAGTTGCGA
CCATGTCCATCGCATCGAGCACGATATGATTGCACGCCGGACCCAGCCTGATTTTGATCAGGTGAGTAGCCGATG
ACTCCTGGTGGTGGTGAGATGAGCTAAACTGACTGTCCGGGACGTAGTGGAAAGCGGAAGAGACACATGTCATTT
CGAGGTGGCTGATGAGTTGCACGCGGAACATCACCTGGGGTAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail