Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3730
Gene name
Locationscaffold_294:6587..7760
Strand-
Gene length (bp)1173
Transcript length (bp)1065
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01916 DS Deoxyhypusine synthase 2.9E-126 48 349

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49365|DHYS_NEUCR Deoxyhypusine synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dys-1 PE=1 SV=2 11 352 0.0E+00
sp|Q6CG56|DHYS_YARLI Deoxyhypusine synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DYS1 PE=3 SV=1 8 352 7.0E-158
sp|Q6CNG7|DHYS_KLULA Deoxyhypusine synthase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DYS1 PE=3 SV=1 11 351 2.0E-152
sp|Q75EW4|DHYS_ASHGO Deoxyhypusine synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DYS1 PE=3 SV=1 18 353 2.0E-150
sp|Q6FRN2|DHYS_CANGA Deoxyhypusine synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DYS1 PE=3 SV=1 11 353 3.0E-150
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49365|DHYS_NEUCR Deoxyhypusine synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dys-1 PE=1 SV=2 11 352 0.0E+00
sp|Q6CG56|DHYS_YARLI Deoxyhypusine synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DYS1 PE=3 SV=1 8 352 7.0E-158
sp|Q6CNG7|DHYS_KLULA Deoxyhypusine synthase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DYS1 PE=3 SV=1 11 351 2.0E-152
sp|Q75EW4|DHYS_ASHGO Deoxyhypusine synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DYS1 PE=3 SV=1 18 353 2.0E-150
sp|Q6FRN2|DHYS_CANGA Deoxyhypusine synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DYS1 PE=3 SV=1 11 353 3.0E-150
sp|Q6BJH5|DHYS_DEBHA Deoxyhypusine synthase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DYS1 PE=3 SV=1 11 351 8.0E-149
sp|P38791|DHYS_YEAST Deoxyhypusine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DYS1 PE=1 SV=1 11 353 8.0E-148
sp|O94337|DHYS_SCHPO Probable deoxyhypusine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.04c PE=3 SV=2 42 352 2.0E-142
sp|Q6AY53|DHYS_RAT Deoxyhypusine synthase OS=Rattus norvegicus GN=Dhps PE=2 SV=1 6 352 4.0E-139
sp|Q3TXU5|DHYS_MOUSE Deoxyhypusine synthase OS=Mus musculus GN=Dhps PE=1 SV=2 6 352 1.0E-138
sp|Q9XXJ0|DHYS_CAEEL Probable deoxyhypusine synthase OS=Caenorhabditis elegans GN=Y17G7B.4 PE=1 SV=1 12 352 2.0E-138
sp|Q9VSF4|DHYS_DROME Probable deoxyhypusine synthase OS=Drosophila melanogaster GN=CG8005 PE=2 SV=2 8 352 4.0E-138
sp|P49366|DHYS_HUMAN Deoxyhypusine synthase OS=Homo sapiens GN=DHPS PE=1 SV=1 11 352 6.0E-136
sp|Q9SC14|DHYS_SENVE Deoxyhypusine synthase OS=Senecio vernalis GN=DHS1 PE=2 SV=1 18 351 2.0E-132
sp|Q6EWQ6|DHYS_BOVIN Deoxyhypusine synthase OS=Bos taurus GN=DHPS PE=2 SV=2 11 352 1.0E-131
sp|Q9FI94|DHYS_ARATH Deoxyhypusine synthase OS=Arabidopsis thaliana GN=DHS PE=2 SV=1 12 351 2.0E-131
sp|Q54MQ7|DHYS_DICDI Probable deoxyhypusine synthase OS=Dictyostelium discoideum GN=dhps PE=3 SV=1 11 352 4.0E-131
sp|Q6RJS2|DHYS_BRANA Deoxyhypusine synthase OS=Brassica napus GN=DHS PE=2 SV=1 12 351 1.0E-128
sp|Q9SC80|DHYS_TOBAC Deoxyhypusine synthase OS=Nicotiana tabacum GN=DHS1 PE=2 SV=1 18 351 3.0E-127
sp|Q9AXQ8|DHYS_DIACA Deoxyhypusine synthase OS=Dianthus caryophyllus GN=DHS PE=2 SV=1 12 351 5.0E-127
sp|Q9AXR0|DHYS_SOLLC Deoxyhypusine synthase OS=Solanum lycopersicum GN=DHS PE=2 SV=1 18 354 1.0E-126
sp|Q9M4B0|HSS1_SENVU Homospermidine synthase OS=Senecio vulgaris GN=HSS1 PE=1 SV=1 13 351 5.0E-123
sp|P60038|HSS2_SENVE Homospermidine synthase 2 OS=Senecio vernalis PE=1 SV=1 13 351 7.0E-123
sp|Q9SC13|HSS1_SENVE Homospermidine synthase 1 OS=Senecio vernalis GN=HSS1 PE=1 SV=1 13 351 8.0E-123
sp|Q9AXQ9|DHYS_MUSAC Deoxyhypusine synthase OS=Musa acuminata GN=DHS PE=2 SV=1 18 352 4.0E-122
sp|Q8SQN2|DHYS_ENCCU Deoxyhypusine synthase OS=Encephalitozoon cuniculi (strain GB-M1) GN=DYS1 PE=3 SV=2 49 352 1.0E-89
sp|Q8U407|DHYS_PYRFU Probable deoxyhypusine synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=dys PE=3 SV=2 20 346 8.0E-89
sp|O50105|DHYS_PYRHO Probable deoxyhypusine synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=dys PE=1 SV=1 33 346 5.0E-88
sp|B6YVB1|DHYS_THEON Probable deoxyhypusine synthase OS=Thermococcus onnurineus (strain NA1) GN=dys PE=3 SV=1 18 346 1.0E-86
sp|C5A5L0|DHYS_THEGJ Probable deoxyhypusine synthase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=dys PE=3 SV=1 18 346 1.0E-86
sp|Q5JEY0|DHYS_THEKO Probable deoxyhypusine synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=dys PE=3 SV=1 18 346 6.0E-86
sp|Q9V0N5|DHYS_PYRAB Probable deoxyhypusine synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=dys PE=3 SV=1 14 346 2.0E-85
sp|Q58224|DHYS_METJA Probable deoxyhypusine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dys PE=3 SV=3 33 346 2.0E-79
sp|A6URC0|DHYS_METVS Probable deoxyhypusine synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=dys PE=3 SV=1 17 350 5.0E-76
sp|A4ZZ93|DHYSL_LEIDO Inactive deoxyhypusine synthase OS=Leishmania donovani PE=1 SV=1 8 351 2.0E-64
sp|B0R5L2|DHYS_HALS3 Probable deoxyhypusine synthase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=dys PE=3 SV=1 48 350 1.0E-61
sp|Q9HPX2|DHYS_HALSA Probable deoxyhypusine synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dys PE=3 SV=1 48 350 1.0E-61
sp|Q97BN6|DHYS_THEVO Probable deoxyhypusine synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dys PE=3 SV=1 29 347 5.0E-60
sp|Q6KZL5|DHYS_PICTO Probable deoxyhypusine synthase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dys PE=3 SV=1 30 347 6.0E-60
sp|Q9HL74|DHYS_THEAC Probable deoxyhypusine synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dys PE=3 SV=2 29 347 2.0E-59
sp|Q971T3|DHYS_SULTO Probable deoxyhypusine synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=dys PE=3 SV=1 29 348 3.0E-52
sp|Q4J978|DHYS_SULAC Probable deoxyhypusine synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=dys PE=3 SV=1 45 348 2.0E-50
sp|A4YHK6|DHYS_METS5 Probable deoxyhypusine synthase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=dys PE=3 SV=1 44 345 2.0E-48
sp|C3MYN2|DHYS_SULIM Probable deoxyhypusine synthase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=dys PE=3 SV=1 57 351 6.0E-48
sp|C3N5B4|DHYS_SULIA Probable deoxyhypusine synthase OS=Sulfolobus islandicus (strain M.16.27) GN=dys PE=3 SV=1 57 351 6.0E-48
sp|C3MPN8|DHYS_SULIL Probable deoxyhypusine synthase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=dys PE=3 SV=1 57 351 6.0E-48
sp|C3NHT5|DHYS_SULIN Probable deoxyhypusine synthase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=dys PE=3 SV=1 57 351 6.0E-48
sp|C3NDW8|DHYS_SULIY Probable deoxyhypusine synthase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=dys PE=3 SV=1 57 351 6.0E-48
sp|C4KGY0|DHYS_SULIK Probable deoxyhypusine synthase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=dys PE=3 SV=1 57 351 6.0E-48
sp|Q97ZF1|DHYS_SULSO Probable deoxyhypusine synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dys PE=3 SV=1 30 351 9.0E-48
sp|A8AA61|DHYS_IGNH4 Probable deoxyhypusine synthase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=dys PE=3 SV=1 30 352 3.0E-47
sp|Q9YE72|DHYS_AERPE Probable deoxyhypusine synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=dys PE=3 SV=2 32 345 4.0E-41
sp|A3MVC9|DHYS_PYRCJ Probable deoxyhypusine synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=dys PE=3 SV=1 54 346 2.0E-40
sp|Q8ZT09|DHYS_PYRAE Probable deoxyhypusine synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=dys PE=3 SV=1 57 346 9.0E-36
sp|Q8TS38|DHYS1_METAC Probable deoxyhypusine synthase 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dys1 PE=3 SV=1 44 347 3.0E-35
sp|O26230|DHYS_METTH Probable deoxyhypusine synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dys PE=3 SV=1 84 352 1.0E-33
sp|Q8PV89|DHYS1_METMA Probable deoxyhypusine synthase 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dys1 PE=3 SV=1 44 347 6.0E-33
sp|B3QLU4|DHSL_CHLP8 Deoxyhypusine synthase-like protein OS=Chlorobaculum parvum (strain NCIB 8327) GN=Cpar_2043 PE=3 SV=1 49 352 2.0E-32
sp|Q977X6|DHYS_METTE Probable deoxyhypusine synthase OS=Methanosarcina thermophila GN=dys PE=3 SV=2 44 347 4.0E-32
sp|Q8KGF7|DHSL_CHLTE Deoxyhypusine synthase-like protein OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0011 PE=3 SV=1 49 352 6.0E-32
sp|B5APK2|DHYS_LEIDO Deoxyhypusine synthase OS=Leishmania donovani PE=1 SV=1 249 350 6.0E-28
sp|A9KDQ8|DHSL_COXBN Deoxyhypusine synthase-like protein OS=Coxiella burnetii (strain Dugway 5J108-111) GN=CBUD_0732 PE=3 SV=1 30 353 3.0E-27
sp|A9NCJ8|DHSL_COXBR Deoxyhypusine synthase-like protein OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=COXBURSA331_A0839 PE=3 SV=1 30 353 3.0E-27
sp|P59650|DHSL_COXBU Deoxyhypusine synthase-like protein OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=CBU_0721 PE=3 SV=1 30 353 3.0E-27
sp|B2KER6|DHSL_ELUMP Deoxyhypusine synthase-like protein OS=Elusimicrobium minutum (strain Pei191) GN=Emin_1464 PE=3 SV=1 31 352 7.0E-26
sp|Q8TLM3|DHYS2_METAC Probable deoxyhypusine synthase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dys2 PE=3 SV=1 45 345 9.0E-26
sp|O27984|DHYS2_ARCFU Probable deoxyhypusine synthase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=dys2 PE=3 SV=1 53 345 9.0E-25
sp|Q8Q051|DHYS2_METMA Probable deoxyhypusine synthase 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dys2 PE=3 SV=1 45 345 9.0E-25
sp|O28088|DHYS1_ARCFU Probable deoxyhypusine synthase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=dys1 PE=3 SV=1 44 347 3.0E-21
sp|Q9AB72|DHSL_CAUCR Deoxyhypusine synthase-like protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=CC_0359 PE=3 SV=1 49 350 2.0E-19
sp|Q8TXD7|DHYS_METKA Probable deoxyhypusine synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=dys PE=3 SV=1 41 352 2.0E-19
sp|B2IZP9|DHSL_NOSP7 Deoxyhypusine synthase-like protein OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_F1484 PE=3 SV=1 107 352 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008612 peptidyl-lysine modification to peptidyl-hypusine Yes
GO:0018193 peptidyl-amino acid modification No
GO:0043170 macromolecule metabolic process No
GO:0009058 biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0036211 protein modification process No
GO:0018205 peptidyl-lysine modification No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:0051604 protein maturation No
GO:0008150 biological_process No
GO:0043412 macromolecule modification No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3730
MAQPDPSSAPPATATGAVLKPSESLPPEAQPVEELDFNHLKGPITADDLLRGMRNMGFQASSMAEAIRIINDMRA
WRDADSGEKTTIFLGYTSNLISSGLRGVLRWLVEHNHVSCIVATAGGVEEDFIKCLGSTYMSSFDAEGADLRRRG
LNRIGNLVVPNANYCAFEDWLIPILNKMLEEQEAAKNTEAEVNWTPSKIIHRLGKEIDDERSVYYWAYKNNIPVF
CPALTDGSLGDMLYFHTFMSSPLQLKVDIVEDIRRINTISVRAKRAGIIILGGGVVKHHIANACLMRNGAESAVY
INTAQEFDGSDAGARPDEAVSWGKIKIGADSVKVYLEATACFPFIVANTFAKGS
Coding >Ophio5|3730
ATGGCACAGCCTGATCCCAGCAGTGCGCCGCCGGCGACCGCCACCGGCGCCGTTCTCAAACCGTCCGAATCCTTG
CCTCCTGAGGCTCAGCCGGTGGAAGAGCTCGACTTCAACCATCTAAAGGGGCCCATCACTGCCGACGACCTGCTC
CGGGGCATGCGCAACATGGGGTTCCAGGCGTCTTCCATGGCCGAGGCAATCCGCATCATCAACGACATGCGGGCG
TGGAGAGACGCCGACTCCGGGGAAAAGACGACCATATTTCTCGGCTACACGTCCAATCTGATATCATCCGGTCTC
AGGGGCGTCCTCCGCTGGCTGGTTGAGCACAATCACGTGTCCTGCATCGTTGCAACGGCCGGCGGCGTCGAGGAA
GACTTCATCAAGTGCCTTGGAAGCACCTACATGAGTTCCTTCGATGCCGAGGGCGCGGATCTGCGGCGCAGGGGC
CTCAACCGCATCGGCAACCTCGTTGTCCCTAACGCAAACTACTGCGCCTTTGAAGACTGGCTCATCCCTATCCTC
AACAAGATGCTCGAGGAGCAGGAGGCCGCCAAAAATACCGAAGCCGAGGTCAATTGGACTCCGTCCAAAATCATT
CATCGCCTCGGCAAAGAGATTGACGACGAGCGGTCCGTTTACTACTGGGCATACAAGAACAACATCCCCGTCTTC
TGCCCGGCGCTGACCGACGGCAGCCTCGGCGACATGCTCTACTTTCACACCTTCATGTCGTCACCGCTGCAGCTG
AAAGTGGACATTGTCGAAGACATTCGACGAATCAACACCATTTCTGTTCGTGCCAAGAGGGCTGGCATCATCATC
CTCGGCGGTGGGGTCGTCAAGCATCATATCGCCAACGCTTGTCTCATGCGTAACGGTGCCGAGTCTGCCGTCTAC
ATCAACACGGCCCAGGAGTTTGACGGGAGCGATGCCGGCGCCAGGCCCGACGAGGCGGTGTCGTGGGGCAAGATC
AAGATAGGCGCAGACAGCGTCAAGGTATACCTGGAAGCGACCGCCTGCTTTCCCTTTATCGTCGCCAACACGTTT
GCCAAGGGCTCA
Transcript >Ophio5|3730
ATGGCACAGCCTGATCCCAGCAGTGCGCCGCCGGCGACCGCCACCGGCGCCGTTCTCAAACCGTCCGAATCCTTG
CCTCCTGAGGCTCAGCCGGTGGAAGAGCTCGACTTCAACCATCTAAAGGGGCCCATCACTGCCGACGACCTGCTC
CGGGGCATGCGCAACATGGGGTTCCAGGCGTCTTCCATGGCCGAGGCAATCCGCATCATCAACGACATGCGGGCG
TGGAGAGACGCCGACTCCGGGGAAAAGACGACCATATTTCTCGGCTACACGTCCAATCTGATATCATCCGGTCTC
AGGGGCGTCCTCCGCTGGCTGGTTGAGCACAATCACGTGTCCTGCATCGTTGCAACGGCCGGCGGCGTCGAGGAA
GACTTCATCAAGTGCCTTGGAAGCACCTACATGAGTTCCTTCGATGCCGAGGGCGCGGATCTGCGGCGCAGGGGC
CTCAACCGCATCGGCAACCTCGTTGTCCCTAACGCAAACTACTGCGCCTTTGAAGACTGGCTCATCCCTATCCTC
AACAAGATGCTCGAGGAGCAGGAGGCCGCCAAAAATACCGAAGCCGAGGTCAATTGGACTCCGTCCAAAATCATT
CATCGCCTCGGCAAAGAGATTGACGACGAGCGGTCCGTTTACTACTGGGCATACAAGAACAACATCCCCGTCTTC
TGCCCGGCGCTGACCGACGGCAGCCTCGGCGACATGCTCTACTTTCACACCTTCATGTCGTCACCGCTGCAGCTG
AAAGTGGACATTGTCGAAGACATTCGACGAATCAACACCATTTCTGTTCGTGCCAAGAGGGCTGGCATCATCATC
CTCGGCGGTGGGGTCGTCAAGCATCATATCGCCAACGCTTGTCTCATGCGTAACGGTGCCGAGTCTGCCGTCTAC
ATCAACACGGCCCAGGAGTTTGACGGGAGCGATGCCGGCGCCAGGCCCGACGAGGCGGTGTCGTGGGGCAAGATC
AAGATAGGCGCAGACAGCGTCAAGGTATACCTGGAAGCGACCGCCTGCTTTCCCTTTATCGTCGCCAACACGTTT
GCCAAGGGCTCATAG
Gene >Ophio5|3730
ATGGCACAGCCTGATCCCAGCAGTGCGCCGCCGGCGACCGCCACCGGCGCCGTTCTCAAACCGTCCGAATCCTTG
CCTCCTGAGGCTCAGCCGGTGGAAGAGCTCGACTTCAACCATCTAAAGGGGCCCATCACTGCCGACGACCTGCTC
CGGGGCATGCGCAACATGGGGTTCCAGGCGTCTTCCATGGCCGAGGCAATCCGCATCATCAACGACATGGTACGT
CCGTAGCCGTACTTTTTGTCGCGGCGAGACTGAATCCCTCGACAGCGGGCGTGGAGAGACGCCGACTCCGGGGAA
AAGACGACCATATTTCTCGGCTACACGTCCAATCTGATATCATCCGGTCTCAGGGGCGTCCTCCGCTGGCTGGTT
GAGCACAATCACGTGTCCTGCATCGTTGCAACGGCCGGCGGCGTCGAGGAAGACTTCATCAAGTGCCTTGGAAGC
ACCTACATGAGTTCCTTCGATGCCGAGGGCGCGGATCTGCGGCGCAGGGGCCTCAACCGCATCGGCAACCTCGTT
GTCCCTAACGCAAACTACTGCGCCTTTGAAGACTGGCTCATCCCTATCCTCAACAAGATGCTCGAGGAGCAGGAG
GCCGCCAAAAATACCGAAGCCGAGGTCAATTGGACTCCGTCCAAAATCATTCATCGCCTCGGCAAAGAGATTGAC
GACGAGCGGTCCGTTTACTACTGGGCATACAAGAACAACATCCCCGTCTTCTGCCCGGCGCTGACCGACGGCAGC
CTCGGCGACATGCTCTACTTTCACACCTTCATGTCGTCACCGCTGCAGCTGAAAGTGGACATTGTCGAAGACATT
CGACGAATCAACACCATTTCTGTTCGTGCCAAGAGGGCTGGCATCATCATCCTCGGCGGTGGGGTCGTCAAGCAT
CATATCGCCAACGCTTGTCTCATGCGTAACGGTGCCGAGTCTGCCGTCTACATCAACACGGCCCAGGAGTTTGAC
GGGAGCGATGCCGGCGCCAGGCCCGACGAGGCGGTGTCGTGGGGCAAGATCAAGATAGGCGCAGACAGCGTCAAG
GTAATCACACATTATCTCAGATGCTAATCATCACGGCCAACTGACGAGGCCTGATAGGTATACCTGGAAGCGACC
GCCTGCTTTCCCTTTATCGTCGCCAACACGTTTGCCAAGGGCTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail