Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3721
Gene name
Locationscaffold_293:12930..15135
Strand-
Gene length (bp)2205
Transcript length (bp)2148
Coding sequence length (bp)2145
Protein length (aa) 715

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00368 HMG-CoA_red Hydroxymethylglutaryl-coenzyme A reductase 2.4E-139 323 706

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT44|HMDH_GIBFU 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Gibberella fujikuroi GN=HMGR PE=3 SV=1 192 707 0.0E+00
sp|S0DQM8|HMDH_GIBF5 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=HMGR PE=3 SV=1 192 707 0.0E+00
sp|O74164|HMDH_CYBJA 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Cyberlindnera jadinii GN=HMG PE=2 SV=1 275 706 0.0E+00
sp|Q9Y7D2|HMDH_ASPTE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Aspergillus terreus PE=3 SV=2 256 707 0.0E+00
sp|Q0C8L9|HMDH_ASPTN 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_09965 PE=3 SV=1 256 707 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT44|HMDH_GIBFU 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Gibberella fujikuroi GN=HMGR PE=3 SV=1 192 707 0.0E+00
sp|S0DQM8|HMDH_GIBF5 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=HMGR PE=3 SV=1 192 707 0.0E+00
sp|O74164|HMDH_CYBJA 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Cyberlindnera jadinii GN=HMG PE=2 SV=1 275 706 0.0E+00
sp|Q9Y7D2|HMDH_ASPTE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Aspergillus terreus PE=3 SV=2 256 707 0.0E+00
sp|Q0C8L9|HMDH_ASPTN 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_09965 PE=3 SV=1 256 707 0.0E+00
sp|P12683|HMDH1_YEAST 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMG1 PE=1 SV=1 275 712 0.0E+00
sp|P12684|HMDH2_YEAST 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMG2 PE=1 SV=1 273 706 0.0E+00
sp|Q10283|HMDH_SCHPO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmg1 PE=1 SV=2 275 712 0.0E+00
sp|Q12649|HMDH_PHYB8 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=hmgA PE=3 SV=2 280 712 1.0E-176
sp|P34136|HMDH2_DICDI 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Dictyostelium discoideum GN=hmgB PE=2 SV=2 291 715 1.0E-165
sp|P16393|HMDH_STRPU 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Strongylocentrotus purpuratus GN=HMGCR PE=2 SV=2 274 707 4.0E-155
sp|P09610|HMDH_MESAU 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Mesocricetus auratus GN=HMGCR PE=1 SV=1 257 707 2.0E-154
sp|P00347|HMDH_CRIGR 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Cricetulus griseus GN=HMGCR PE=1 SV=1 258 707 4.0E-154
sp|Q01237|HMDH_MOUSE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Mus musculus GN=Hmgcr PE=1 SV=3 258 707 4.0E-154
sp|O24594|HMDH_MAIZE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Zea mays GN=HMGR PE=3 SV=1 294 713 3.0E-153
sp|P29057|HMDH1_HEVBR 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Hevea brasiliensis GN=HMGR1 PE=2 SV=1 199 715 5.0E-153
sp|P54960|HMDH_BLAGE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Blattella germanica PE=2 SV=1 255 712 6.0E-153
sp|P51639|HMDH_RAT 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Rattus norvegicus GN=Hmgcr PE=1 SV=2 216 707 6.0E-153
sp|P48021|HMDH_CAMAC 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Camptotheca acuminata PE=3 SV=1 252 709 7.0E-153
sp|P20715|HMDH_XENLA 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Xenopus laevis GN=hmgcr PE=2 SV=1 264 707 6.0E-152
sp|A7Z064|HMDH_BOVIN 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Bos taurus GN=HMGCR PE=2 SV=2 264 707 8.0E-152
sp|Q5R6N3|HMDH_PONAB 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Pongo abelii GN=HMGCR PE=2 SV=1 270 707 1.0E-151
sp|P04035|HMDH_HUMAN 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Homo sapiens GN=HMGCR PE=1 SV=1 270 707 3.0E-151
sp|Q01559|HMDH_NICSY 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Nicotiana sylvestris GN=HMGR PE=2 SV=1 294 709 5.0E-151
sp|O64966|HMDH1_GOSHI 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Gossypium hirsutum GN=HMG1 PE=3 SV=1 267 706 5.0E-151
sp|Q03163|HMDH_CATRO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Catharanthus roseus GN=HMGR PE=2 SV=1 252 709 9.0E-151
sp|O64967|HMDH2_GOSHI 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Gossypium hirsutum GN=HMG2 PE=3 SV=1 219 712 2.0E-150
sp|P48020|HMDH1_SOLTU 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Solanum tuberosum GN=HMG1 PE=2 SV=1 294 712 3.0E-150
sp|Q9XHL5|HMDH3_ORYSJ 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 OS=Oryza sativa subsp. japonica GN=HMG3 PE=2 SV=2 294 712 3.0E-150
sp|Q9XEL8|HMDH2_CAPAN 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Capsicum annuum GN=HMGR2 PE=2 SV=1 294 709 6.0E-150
sp|Q1W675|HMDH_PIG 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Sus scrofa GN=HMGCR PE=2 SV=1 270 707 8.0E-150
sp|Q29512|HMDH_RABIT 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Oryctolagus cuniculus GN=HMGCR PE=3 SV=1 265 707 2.0E-149
sp|P48022|HMDH2_SOLLC 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Solanum lycopersicum GN=HMG2 PE=3 SV=1 199 709 2.0E-148
sp|Q41438|HMDH3_SOLTU 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 OS=Solanum tuberosum GN=HMG3 PE=2 SV=1 294 709 5.0E-148
sp|P34135|HMDH1_DICDI 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Dictyostelium discoideum GN=hmgA PE=2 SV=1 291 706 8.0E-148
sp|P43256|HMDH2_ARATH 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Arabidopsis thaliana GN=HMG2 PE=2 SV=1 269 707 9.0E-148
sp|Q00583|HMDH3_HEVBR 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 OS=Hevea brasiliensis GN=HMGR3 PE=2 SV=1 295 712 1.0E-146
sp|Q41437|HMDH2_SOLTU 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Solanum tuberosum GN=HMG2 PE=2 SV=1 199 712 1.0E-146
sp|P14891|HMDH1_ARATH 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Arabidopsis thaliana GN=HMG1 PE=1 SV=1 254 707 1.0E-145
sp|Q0DY59|HMDH1_ORYSJ 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Oryza sativa subsp. japonica GN=HMG1 PE=2 SV=2 291 709 4.0E-144
sp|A2X8W3|HMDH1_ORYSI 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Oryza sativa subsp. indica GN=HMG1 PE=2 SV=2 291 709 5.0E-144
sp|O76819|HMDH_AGRIP 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Agrotis ipsilon GN=HMGR PE=2 SV=1 254 707 6.0E-141
sp|P14773|HMDH_DROME 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Drosophila melanogaster GN=Hmgcr PE=2 SV=2 236 707 2.0E-135
sp|P16237|HMDH_SCHMA 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Schistosoma mansoni PE=2 SV=1 265 715 3.0E-114
sp|O59469|HMDH_PYRHO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hmgA PE=3 SV=2 295 706 5.0E-99
sp|Q9V1R3|HMDH_PYRAB 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hmgA PE=3 SV=2 292 706 3.0E-97
sp|O26662|HMDH_METTH 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hmgA PE=3 SV=1 301 706 2.0E-93
sp|Q59468|HMDH_HALVD 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=hmgA PE=1 SV=2 292 706 6.0E-85
sp|O08424|HMDH_SULSO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hmgA PE=1 SV=2 355 709 1.0E-84
sp|Q9YAS4|HMDH_AERPE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hmgA PE=3 SV=1 295 701 2.0E-83
sp|Q58116|HMDH_METJA 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hmgA PE=3 SV=1 365 706 1.0E-78
sp|P29058|HMDH2_HEVBR 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 (Fragment) OS=Hevea brasiliensis GN=HMGR2 PE=2 SV=1 513 715 1.0E-74
sp|B0R6J9|HMDH_HALS3 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hmgA PE=1 SV=1 364 706 2.0E-73
[Show less]

GO

GO Term Description Terminal node
GO:0004420 hydroxymethylglutaryl-CoA reductase (NADPH) activity Yes
GO:0015936 coenzyme A metabolic process Yes
GO:0046483 heterocycle metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0033875 ribonucleoside bisphosphate metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0016491 oxidoreductase activity No
GO:0044238 primary metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0006725 cellular aromatic compound metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0034032 purine nucleoside bisphosphate metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0033865 nucleoside bisphosphate metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

Domain # Start End Length
1 30 49 19
2 195 214 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3721
MDKNLASPSLRHSNSLSLKAPRLVQHLSHMAARLPVHALLLIILSTSLLQDSIFRGNARVVPSSLRQSLDHENHR
HSTLVTMVFTDVLSSKAVLPCSVPAHDNISVALLDPNAAPLTACPPSQLRSYWRAPESRPAVQAMSQQVPGRRGQ
MTRWLVKAAQATDSPTSQHARADDLEGVSSAALPKKRVNGYKDSLWTNSILLFLILAVGFHGYLRQSAASVAHVP
GLEDTISAHLLDERKQAASNTATDELALPQTAPVSAGRPENRSPVPSEPRSQEQLDELLTEKRACEMTDQELVSV
VLRGKVPGHALEKTLNNDFERAIRIRRNVIPLTDQSTASTAETLDESKLPYDNYDWSRVSGACCENVVGYVPIPV
GVAGPLLVDGKSYMVPMATTEGTLVASTSRGCKAINQAGGAVTVLTSDGMTRGPCISFETLARAGVAKKWVDSEA
GQETIRTAFNSTSSFARLQSIKTAMAGTQLFIRFKAATGDAMGMNMISKGVEHALKVMRSKGFDDMVITSLSGNY
CTDKKASALNWIEGRGKSIVAEAIIPAEVVRSVLKTDVESLVELNTSKNLIGSAMAGSVGGFNAHAANIVAAIFL
ATGQDPAQVVESANCITIMKNVRGSLQISVSMPSIEVGTLGGGTVLEPQGAMLDLLGVKGADVARPGENAGRLAC
IIGAAVLAGELSLCSALAAGHLVDAHMQHNRTLKSPSTRA
Coding >Ophio5|3721
ATGGACAAGAATCTTGCATCTCCTTCTTTGCGGCATTCGAACAGCCTGAGTCTGAAGGCGCCACGCCTCGTCCAG
CATCTGTCCCACATGGCAGCACGACTCCCCGTTCACGCCCTCCTGCTCATCATCCTCAGCACCTCTCTTCTCCAG
GACTCGATATTTAGAGGTAATGCAAGAGTGGTGCCGTCGAGCTTACGCCAGAGCCTCGACCACGAAAACCACCGT
CATTCCACACTCGTTACCATGGTCTTCACAGACGTCCTTTCCAGCAAGGCTGTGCTTCCCTGCAGCGTCCCAGCT
CACGACAACATCTCCGTCGCGCTCCTCGATCCCAACGCGGCCCCACTGACGGCTTGCCCACCCTCGCAGCTTCGC
TCTTACTGGCGGGCGCCTGAGTCCCGACCTGCTGTCCAAGCCATGTCGCAACAAGTGCCCGGCCGAAGAGGTCAG
ATGACGAGATGGCTCGTCAAAGCCGCCCAGGCCACCGACTCTCCAACCAGCCAGCATGCGCGGGCCGATGATCTG
GAGGGCGTCTCCTCCGCTGCGTTGCCTAAAAAGCGCGTCAATGGCTACAAGGACTCTCTCTGGACCAACTCGATC
CTGCTCTTCTTGATCTTGGCCGTTGGCTTCCATGGATACCTACGGCAAAGTGCAGCTTCCGTCGCCCATGTCCCT
GGTCTTGAGGATACAATCTCTGCTCATTTGCTCGACGAAAGGAAGCAGGCGGCGTCCAACACGGCCACTGACGAG
CTTGCTTTGCCACAGACGGCCCCCGTCTCAGCTGGTAGACCAGAGAATCGGTCCCCTGTCCCTTCGGAGCCGCGC
TCACAGGAGCAACTAGACGAGCTGCTGACTGAGAAGAGAGCCTGCGAAATGACCGACCAAGAACTCGTCTCCGTC
GTATTGCGTGGCAAAGTTCCCGGACACGCCCTGGAAAAGACGCTCAACAACGACTTCGAGCGTGCCATTCGCATC
AGGCGCAACGTCATCCCCCTGACCGACCAGTCTACAGCATCCACGGCAGAGACTTTAGACGAGTCCAAGCTGCCG
TACGACAACTATGACTGGAGCCGCGTTTCCGGAGCCTGCTGTGAGAACGTGGTGGGCTACGTTCCCATCCCCGTC
GGCGTGGCTGGTCCCCTCCTCGTCGATGGCAAGAGTTACATGGTTCCTATGGCCACGACCGAAGGAACCTTGGTC
GCTAGCACCAGCAGGGGTTGCAAGGCAATCAACCAGGCCGGTGGCGCCGTGACAGTCTTGACGTCCGACGGCATG
ACGCGGGGCCCCTGCATCAGCTTCGAAACCCTGGCGAGGGCCGGTGTAGCCAAGAAGTGGGTAGATTCGGAGGCC
GGACAAGAGACTATCCGTACGGCTTTCAACTCAACCAGCAGCTTTGCGCGCCTCCAGTCCATCAAGACGGCAATG
GCTGGAACGCAGCTTTTTATCCGGTTCAAGGCAGCCACCGGTGACGCCATGGGCATGAATATGATATCCAAGGGC
GTGGAGCACGCGCTCAAGGTCATGAGGTCCAAGGGCTTTGACGATATGGTCATCACCTCCCTCTCGGGCAACTAC
TGTACCGATAAGAAGGCCTCTGCACTAAACTGGATCGAGGGACGCGGAAAAAGCATTGTGGCCGAGGCTATTATC
CCGGCCGAGGTCGTGAGAAGCGTGCTTAAGACCGACGTGGAATCCCTTGTCGAGTTAAATACGTCTAAAAACCTA
ATCGGATCGGCCATGGCGGGTTCGGTCGGTGGCTTTAACGCCCACGCAGCCAACATCGTGGCCGCGATATTCTTG
GCCACGGGGCAAGACCCCGCGCAGGTGGTTGAAAGCGCCAACTGCATCACCATCATGAAGAATGTACGCGGCTCG
CTTCAAATATCAGTCTCGATGCCGTCCATCGAAGTAGGCACCCTCGGCGGTGGCACCGTACTCGAGCCCCAAGGC
GCCATGCTTGATCTTCTTGGTGTCAAGGGTGCCGATGTGGCTAGGCCGGGTGAGAACGCAGGCCGGCTGGCTTGC
ATCATCGGCGCGGCTGTTCTGGCCGGCGAGTTGTCTTTATGCAGTGCCCTGGCTGCCGGTCACCTCGTTGATGCA
CACATGCAGCATAATCGGACTTTGAAGAGCCCCTCTACCAGAGCT
Transcript >Ophio5|3721
ATGGACAAGAATCTTGCATCTCCTTCTTTGCGGCATTCGAACAGCCTGAGTCTGAAGGCGCCACGCCTCGTCCAG
CATCTGTCCCACATGGCAGCACGACTCCCCGTTCACGCCCTCCTGCTCATCATCCTCAGCACCTCTCTTCTCCAG
GACTCGATATTTAGAGGTAATGCAAGAGTGGTGCCGTCGAGCTTACGCCAGAGCCTCGACCACGAAAACCACCGT
CATTCCACACTCGTTACCATGGTCTTCACAGACGTCCTTTCCAGCAAGGCTGTGCTTCCCTGCAGCGTCCCAGCT
CACGACAACATCTCCGTCGCGCTCCTCGATCCCAACGCGGCCCCACTGACGGCTTGCCCACCCTCGCAGCTTCGC
TCTTACTGGCGGGCGCCTGAGTCCCGACCTGCTGTCCAAGCCATGTCGCAACAAGTGCCCGGCCGAAGAGGTCAG
ATGACGAGATGGCTCGTCAAAGCCGCCCAGGCCACCGACTCTCCAACCAGCCAGCATGCGCGGGCCGATGATCTG
GAGGGCGTCTCCTCCGCTGCGTTGCCTAAAAAGCGCGTCAATGGCTACAAGGACTCTCTCTGGACCAACTCGATC
CTGCTCTTCTTGATCTTGGCCGTTGGCTTCCATGGATACCTACGGCAAAGTGCAGCTTCCGTCGCCCATGTCCCT
GGTCTTGAGGATACAATCTCTGCTCATTTGCTCGACGAAAGGAAGCAGGCGGCGTCCAACACGGCCACTGACGAG
CTTGCTTTGCCACAGACGGCCCCCGTCTCAGCTGGTAGACCAGAGAATCGGTCCCCTGTCCCTTCGGAGCCGCGC
TCACAGGAGCAACTAGACGAGCTGCTGACTGAGAAGAGAGCCTGCGAAATGACCGACCAAGAACTCGTCTCCGTC
GTATTGCGTGGCAAAGTTCCCGGACACGCCCTGGAAAAGACGCTCAACAACGACTTCGAGCGTGCCATTCGCATC
AGGCGCAACGTCATCCCCCTGACCGACCAGTCTACAGCATCCACGGCAGAGACTTTAGACGAGTCCAAGCTGCCG
TACGACAACTATGACTGGAGCCGCGTTTCCGGAGCCTGCTGTGAGAACGTGGTGGGCTACGTTCCCATCCCCGTC
GGCGTGGCTGGTCCCCTCCTCGTCGATGGCAAGAGTTACATGGTTCCTATGGCCACGACCGAAGGAACCTTGGTC
GCTAGCACCAGCAGGGGTTGCAAGGCAATCAACCAGGCCGGTGGCGCCGTGACAGTCTTGACGTCCGACGGCATG
ACGCGGGGCCCCTGCATCAGCTTCGAAACCCTGGCGAGGGCCGGTGTAGCCAAGAAGTGGGTAGATTCGGAGGCC
GGACAAGAGACTATCCGTACGGCTTTCAACTCAACCAGCAGCTTTGCGCGCCTCCAGTCCATCAAGACGGCAATG
GCTGGAACGCAGCTTTTTATCCGGTTCAAGGCAGCCACCGGTGACGCCATGGGCATGAATATGATATCCAAGGGC
GTGGAGCACGCGCTCAAGGTCATGAGGTCCAAGGGCTTTGACGATATGGTCATCACCTCCCTCTCGGGCAACTAC
TGTACCGATAAGAAGGCCTCTGCACTAAACTGGATCGAGGGACGCGGAAAAAGCATTGTGGCCGAGGCTATTATC
CCGGCCGAGGTCGTGAGAAGCGTGCTTAAGACCGACGTGGAATCCCTTGTCGAGTTAAATACGTCTAAAAACCTA
ATCGGATCGGCCATGGCGGGTTCGGTCGGTGGCTTTAACGCCCACGCAGCCAACATCGTGGCCGCGATATTCTTG
GCCACGGGGCAAGACCCCGCGCAGGTGGTTGAAAGCGCCAACTGCATCACCATCATGAAGAATGTACGCGGCTCG
CTTCAAATATCAGTCTCGATGCCGTCCATCGAAGTAGGCACCCTCGGCGGTGGCACCGTACTCGAGCCCCAAGGC
GCCATGCTTGATCTTCTTGGTGTCAAGGGTGCCGATGTGGCTAGGCCGGGTGAGAACGCAGGCCGGCTGGCTTGC
ATCATCGGCGCGGCTGTTCTGGCCGGCGAGTTGTCTTTATGCAGTGCCCTGGCTGCCGGTCACCTCGTTGATGCA
CACATGCAGCATAATCGGACTTTGAAGAGCCCCTCTACCAGAGCTTGA
Gene >Ophio5|3721
ATGGACAAGAATCTTGCATCTCCTTCTTTGCGGCATTCGAACAGCCTGAGTCTGAAGGCGCCACGCCTCGTCCAG
CATCTGTCCCACATGGCAGCACGACTCCCCGTTCACGCCCTCCTGCTCATCATCCTCAGCACCTCTCTTCTCCAG
GACTCGATATTTAGAGGTAATGCAAGAGTGGTGCCGTCGAGCTTACGCCAGAGCCTCGACCACGAAAACCACCGT
CATTCCACACTCGTTACCATGGTCTTCACAGACGTCCTTTCCAGCAAGGCTGTGCTTCCCTGCAGCGTCCCAGCT
CACGACAACATCTCCGTCGCGCTCCTCGATCCCAACGCGGCCCCACTGACGGCTTGCCCACCCTCGCAGCTTCGC
TCTTACTGGCGGGCGCCTGAGTCCCGACCTGCTGTCCAAGCCATGTCGCAACAAGTGCCCGGCCGAAGAGGTCAG
ATGACGAGATGGCTCGTCAAAGCCGCCCAGGCCACCGACTCTCCAACCAGCCAGCATGCGCGGGCCGATGATCTG
GAGGGCGTCTCCTCCGCTGCGTTGCCTAAAAAGCGCGTCAATGGCTACAAGGACTCTCTCTGGACCAACTCGATC
CTGCTCTTCTTGATCTTGGCCGTTGGCTTCCATGGATACCTACGGCAAAGTGCAGCTTCCGTCGCCCATGTCCCT
GGTCTTGAGGATACAATCTCTGCTCATTTGCTCGACGAAAGGAAGCAGGCGGCGTCCAACACGGCCACTGACGAG
CTTGCTTTGCCACAGACGGCCCCCGTCTCAGCTGGTAGACCAGAGAATCGGTCCCCTGTCCCTTCGGAGCCGCGC
TCACAGGAGCAACTAGACGAGCTGCTGACTGAGAAGAGAGCCTGCGAAATGACCGACCAAGAACTCGTCTCCGTC
GTATTGCGTGGCAAAGTTCCCGGACACGCCCTGGAAAAGACGCTCAACAACGACTTCGAGCGTGCCATTCGCATC
AGGCGCAACGTCATCCCCCTGACCGACCAGTCTACAGCATCCACGGCAGAGACTTTAGACGAGTCCAAGCTGCCG
TACGACAACTATGACTGGAGCCGCGTTTCCGGAGCCTGCTGTGAGAACGTGGTGGGCTACGTTCCCATCCCCGTC
GGCGTGGCTGGTCCCCTCCTCGTCGATGGCAAGAGTTACATGGTTCCTATGGCCACGACCGAAGGAACCTTGGTC
GCTAGCACCAGCAGGGGTTGCAAGGCAATCAACCAGGCCGGTGGCGCCGTGACAGTCTTGACGTCCGACGGCATG
ACGCGGGGCCCCTGCATCAGCTTCGAAACCCTGGCGAGGGCCGGTGTAGCCAAGAAGTGGGTAGATTCGGAGGCC
GGACAAGAGACTATCCGTACGGCTTTCAACTCAACCAGCAGCTTTGCGCGCCTCCAGTCCATCAAGACGGCAATG
GCTGGAACGCAGCTTTTTATCCGGTTCAAGGCAGCCACCGGTGACGCCATGGGCATGAATATGATATCCAAGGGC
GTGGAGCACGCGCTCAAGGTCATGAGGTCCAAGGGCTTTGACGATATGGTCATCACCTCCCTCTCGGGCAACTAC
TGTACCGATAAGAAGGCCTCTGCACTAAACTGGATCGAGGGACGCGGAAAAAGCATTGTGGCCGAGGCTATTATC
CCGGCCGAGGTCGTGAGAAGCGTGCTTAAGACCGACGTGGAATCCCTTGTCGAGTTAAATACGTCTAAAAACCTA
ATCGGATCGGCCATGGCGGGTTCGGTCGGTGGCTTTAACGCCCACGCAGCCAACATCGTGGCCGCGATATTCTTG
GCCACGGGGCAAGACCCCGCGCAGGTGGTTGAAAGCGCCAACTGCATCACCATCATGAAGAAGTACGTTGCCGAG
ATGCCTTCCAACTTCACCTTGTCGACTAACACGGCTGGCCCTAGTGTACGCGGCTCGCTTCAAATATCAGTCTCG
ATGCCGTCCATCGAAGTAGGCACCCTCGGCGGTGGCACCGTACTCGAGCCCCAAGGCGCCATGCTTGATCTTCTT
GGTGTCAAGGGTGCCGATGTGGCTAGGCCGGGTGAGAACGCAGGCCGGCTGGCTTGCATCATCGGCGCGGCTGTT
CTGGCCGGCGAGTTGTCTTTATGCAGTGCCCTGGCTGCCGGTCACCTCGTTGATGCACACATGCAGCATAATCGG
ACTTTGAAGAGCCCCTCTACCAGAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail