Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3713
Gene name
Locationscaffold_292:20962..21887
Strand-
Gene length (bp)925
Transcript length (bp)690
Coding sequence length (bp)687
Protein length (aa) 229

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 3.3E-21 104 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13808|GMF1_SCHPO Actin-depolymerizing factor gmf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gmf1 PE=3 SV=1 88 219 7.0E-23
sp|Q12156|AIM7_YEAST Protein AIM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM7 PE=1 SV=1 92 216 5.0E-18
sp|Q5R6P6|GMFB_PONAB Glia maturation factor beta OS=Pongo abelii GN=GMFB PE=2 SV=3 103 227 6.0E-17
sp|P60983|GMFB_HUMAN Glia maturation factor beta OS=Homo sapiens GN=GMFB PE=1 SV=2 103 227 6.0E-17
sp|P60984|GMFB_BOVIN Glia maturation factor beta OS=Bos taurus GN=GMFB PE=1 SV=2 103 227 6.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13808|GMF1_SCHPO Actin-depolymerizing factor gmf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gmf1 PE=3 SV=1 88 219 7.0E-23
sp|Q12156|AIM7_YEAST Protein AIM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM7 PE=1 SV=1 92 216 5.0E-18
sp|Q5R6P6|GMFB_PONAB Glia maturation factor beta OS=Pongo abelii GN=GMFB PE=2 SV=3 103 227 6.0E-17
sp|P60983|GMFB_HUMAN Glia maturation factor beta OS=Homo sapiens GN=GMFB PE=1 SV=2 103 227 6.0E-17
sp|P60984|GMFB_BOVIN Glia maturation factor beta OS=Bos taurus GN=GMFB PE=1 SV=2 103 227 6.0E-17
sp|Q9CQI3|GMFB_MOUSE Glia maturation factor beta OS=Mus musculus GN=Gmfb PE=1 SV=3 103 227 7.0E-17
sp|Q63228|GMFB_RAT Glia maturation factor beta OS=Rattus norvegicus GN=Gmfb PE=1 SV=2 103 227 8.0E-17
sp|Q56JZ9|GMFG_BOVIN Glia maturation factor gamma OS=Bos taurus GN=GMFG PE=2 SV=1 100 219 5.0E-15
sp|Q9ERL7|GMFG_MOUSE Glia maturation factor gamma OS=Mus musculus GN=Gmfg PE=1 SV=1 100 219 7.0E-15
sp|Q80T18|GMFG_RAT Glia maturation factor gamma OS=Rattus norvegicus GN=Gmfg PE=2 SV=1 100 221 2.0E-14
sp|O60234|GMFG_HUMAN Glia maturation factor gamma OS=Homo sapiens GN=GMFG PE=1 SV=1 100 219 3.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5121 0.6488 0.2885 0.0761 0.3815 0.3909 0.3417 0.2266 0.1467 0.0205

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 42.76 19.09 66.43
CcL In ants, during behavior modification 95.06 48.52 141.60
CcD In ants, recently dead 72.45 35.90 108.99

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000770 yes
SC16a CcD 0.039556 yes
CcL CcD 0.292172 no

Orthologs

Orthofinder run ID4
Orthogroup2078
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4406
Ophiocordyceps australis map64 (Brazil) OphauB2|1208
Ophiocordyceps camponoti-floridani Ophcf2|02800
Ophiocordyceps camponoti-rufipedis Ophun1|4565
Ophiocordyceps kimflemingae Ophio5|3713 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2405

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3713
MRRSEYLSRKYFASALPEPGPPGSLIRKTTLPLPRYSCSKYTASHWRRLREAWGSGRRRRYEHDDVAVLLDSLDL
FSSSVSLFYCGNMASESRLFKFSGETKDHLRKFRLTTSRSKEPQAVIYMIDKNTHEIRQDEDKTVYKSLDEVADD
LPDHTPRFILLSYPLTLPDGRMSVPYVLLYYLPNTCNAEVRMLYAGAKELMRNTSEVGKVIDIESAEDLEQIPGK
LGSE
Coding >Ophio5|3713
ATGCGCCGATCCGAGTACCTCAGCCGCAAGTACTTTGCTTCAGCCTTGCCGGAACCCGGCCCACCAGGTTCTCTA
ATCCGCAAGACTACTTTGCCCCTCCCGAGATACTCTTGCAGCAAGTATACGGCGAGTCATTGGCGGAGACTGCGG
GAGGCGTGGGGCTCCGGTCGACGTCGCAGGTACGAACACGACGACGTCGCTGTTCTGTTGGACAGCCTCGACCTT
TTCTCCTCCTCTGTATCTTTATTTTATTGCGGCAACATGGCATCGGAGTCGAGGCTGTTCAAGTTCTCCGGCGAA
ACGAAAGACCATCTGCGCAAGTTTCGTCTCACTACTTCGCGGTCCAAGGAGCCCCAAGCCGTCATATACATGATC
GATAAAAACACGCACGAGATTCGCCAGGACGAGGATAAGACGGTATACAAGTCCTTGGATGAGGTCGCAGACGAC
CTGCCAGACCATACGCCTCGCTTCATCCTGCTGAGCTACCCGCTCACGCTGCCCGATGGCCGCATGTCGGTTCCG
TACGTACTGCTCTATTACCTGCCCAACACCTGCAACGCCGAGGTCCGCATGCTGTACGCCGGCGCCAAGGAGCTG
ATGCGGAACACGAGCGAGGTCGGCAAGGTCATCGACATTGAGTCGGCCGAGGATCTGGAGCAGATCCCGGGCAAG
CTGGGGTCCGAG
Transcript >Ophio5|3713
ATGCGCCGATCCGAGTACCTCAGCCGCAAGTACTTTGCTTCAGCCTTGCCGGAACCCGGCCCACCAGGTTCTCTA
ATCCGCAAGACTACTTTGCCCCTCCCGAGATACTCTTGCAGCAAGTATACGGCGAGTCATTGGCGGAGACTGCGG
GAGGCGTGGGGCTCCGGTCGACGTCGCAGGTACGAACACGACGACGTCGCTGTTCTGTTGGACAGCCTCGACCTT
TTCTCCTCCTCTGTATCTTTATTTTATTGCGGCAACATGGCATCGGAGTCGAGGCTGTTCAAGTTCTCCGGCGAA
ACGAAAGACCATCTGCGCAAGTTTCGTCTCACTACTTCGCGGTCCAAGGAGCCCCAAGCCGTCATATACATGATC
GATAAAAACACGCACGAGATTCGCCAGGACGAGGATAAGACGGTATACAAGTCCTTGGATGAGGTCGCAGACGAC
CTGCCAGACCATACGCCTCGCTTCATCCTGCTGAGCTACCCGCTCACGCTGCCCGATGGCCGCATGTCGGTTCCG
TACGTACTGCTCTATTACCTGCCCAACACCTGCAACGCCGAGGTCCGCATGCTGTACGCCGGCGCCAAGGAGCTG
ATGCGGAACACGAGCGAGGTCGGCAAGGTCATCGACATTGAGTCGGCCGAGGATCTGGAGCAGATCCCGGGCAAG
CTGGGGTCCGAGTAG
Gene >Ophio5|3713
ATGCGCCGATCCGAGTACCTCAGCCGCAAGTACTTTGCTTCAGCCTTGCCGGAACCCGGCCCACCAGGTTCTCTA
ATCCGCAAGACTACTTTGCCCCTCCCGAGATACTCTTGCAGCAAGTATACGGCGAGTCATTGGCGGAGACTGCGG
GAGGCGTGGGGCTCCGGTCGACGTCGCAGGTACGAACACGACGACGTCGCTGTTCTGTTGGACAGCCTCGACCTT
TTCTCCTCCTCGTTCGTGCCTCTGTCTTTTCTTTGCCGTCGACTACTATTCCTGTATTGTCTGATATTGTTCACC
AGTGTATCTTTATTTTATTGCGGCAACATGGTAGTACCGTCCCAATCTTCTTTACGCGCCGCCCTGCTGACAGCC
TTTCAGGCATCGGAGTCGAGGCTGTTCAAGTTCTCCGGCGAAACGAAAGACCATCTGCGCAAGTTTCGTCTCACT
ACTTCGCGGTCCAAGGAGCCCCAAGCCGTCATATGTGCGTGCGCCTGTCCTCTGTGCTGTCACGCCAACGACGTA
GCTGATGAGGTACCAGACATGATCGATAAAAACACGCACGAGATTCGCCAGGACGAGGATAAGACGGTATACAAG
TCCTTGGATGAGGTCGCAGACGACCTGCCAGACCATACGCCTCGCTTCATCCTGCTGAGCTACCCGCTCACGCTG
GTGCGTCTTCCCCGTTCCTTGCTACGCCTCTCCGCCACTGACGCGGGCGATGCGACGCCAGCCCGATGGCCGCAT
GTCGGTTCCGTACGTACTGCTCTATTACCTGCCCAACACCTGCAACGCCGAGGTCCGCATGCTGTACGCCGGCGC
CAAGGAGCTGATGCGGAACACGAGCGAGGTCGGCAAGGTCATCGACATTGAGTCGGCCGAGGATCTGGAGCAGAT
CCCGGGCAAGCTGGGGTCCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail