Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3702
Gene name
Locationscaffold_291:23809..24987
Strand+
Gene length (bp)1178
Transcript length (bp)1053
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 1.1E-24 6 344

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24552|OXDA_FUSSO D-amino-acid oxidase OS=Fusarium solani subsp. pisi PE=1 SV=1 3 344 4.0E-25
sp|Q9Y7N4|OXDA_SCHPO D-amino-acid oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dao1 PE=3 SV=1 6 350 1.0E-24
sp|P80324|OXDA_RHOTO D-amino-acid oxidase OS=Rhodosporidium toruloides GN=DAO1 PE=1 SV=1 6 344 1.0E-22
sp|Q99042|OXDA_TRIVR D-amino-acid oxidase OS=Trigonopsis variabilis GN=DAO1 PE=3 SV=1 6 340 5.0E-20
sp|Q556W1|OXDD_DICDI D-aspartate oxidase OS=Dictyostelium discoideum GN=ddo-1 PE=3 SV=1 6 345 9.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24552|OXDA_FUSSO D-amino-acid oxidase OS=Fusarium solani subsp. pisi PE=1 SV=1 3 344 4.0E-25
sp|Q9Y7N4|OXDA_SCHPO D-amino-acid oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dao1 PE=3 SV=1 6 350 1.0E-24
sp|P80324|OXDA_RHOTO D-amino-acid oxidase OS=Rhodosporidium toruloides GN=DAO1 PE=1 SV=1 6 344 1.0E-22
sp|Q99042|OXDA_TRIVR D-amino-acid oxidase OS=Trigonopsis variabilis GN=DAO1 PE=3 SV=1 6 340 5.0E-20
sp|Q556W1|OXDD_DICDI D-aspartate oxidase OS=Dictyostelium discoideum GN=ddo-1 PE=3 SV=1 6 345 9.0E-18
sp|A8XJ44|OXDA_CAEBR D-amino-acid oxidase OS=Caenorhabditis briggsae GN=daao-1 PE=3 SV=1 4 349 8.0E-17
sp|P31228|OXDD_BOVIN D-aspartate oxidase OS=Bos taurus GN=DDO PE=1 SV=2 1 345 3.0E-16
sp|Q99489|OXDD_HUMAN D-aspartate oxidase OS=Homo sapiens GN=DDO PE=2 SV=1 1 344 2.0E-12
sp|Q922Z0|OXDD_MOUSE D-aspartate oxidase OS=Mus musculus GN=Ddo PE=1 SV=1 1 346 2.0E-12
sp|Q95XG9|OXDA_CAEEL D-amino-acid oxidase OS=Caenorhabditis elegans GN=daao-1 PE=1 SV=2 4 350 2.0E-11
sp|P9WP27|DAO_MYCTU Probable D-amino-acid oxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aao PE=1 SV=1 6 344 3.0E-10
sp|P9WP26|DAO_MYCTO Probable D-amino-acid oxidase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aao PE=3 SV=1 6 344 3.0E-10
sp|P22942|OXDA_RABIT D-amino-acid oxidase OS=Oryctolagus cuniculus GN=DAO PE=2 SV=1 6 344 1.0E-08
sp|P00371|OXDA_PIG D-amino-acid oxidase OS=Sus scrofa GN=DAO PE=1 SV=2 6 344 1.0E-08
sp|A8WXM1|OXDD1_CAEBR D-aspartate oxidase 1 OS=Caenorhabditis briggsae GN=CBG04460 PE=3 SV=1 200 349 2.0E-08
sp|Q19564|OXDD2_CAEEL D-aspartate oxidase 2 OS=Caenorhabditis elegans GN=ddo-2 PE=1 SV=1 200 344 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.85 0.00 1.88
CcL In ants, during behavior modification 2.59 0.29 4.89
CcD In ants, recently dead 2.53 0.36 4.71

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.046309 yes
SC16a CcD 0.052575 no
CcL CcD 0.969277 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3702
MASPTIVIIGAGVFGLSCAVNLQAKLAEEDALVRHELVVVACEWPSPTIPGLSSPSVNYASMWAGAHVRPIPATT
PQLQREAKWLKHTVAEFERQMEAEPFCGITRTGGIEYMEEPSAGYSNQDSSTFEQESGLRGYGQIAGCELPEGVA
LGFRYETFCINPSVYCEHLLRKFLLRGGKAKTRHLSSEWDPYSALDQVVLVINASGFGFGDPQCFPTRGQTVLTD
LSVAYTITRQHRDGTKSFLVPRSFCGGTVVGGTTEVRDWRDAPDAATRDRLLASGLAMAGSHGQVKVVGDIVGRR
PTRTDGLRLDVEERSRTERVIHAYGAGGRGYEMSWGVANEVTQLAIPLLR
Coding >Ophio5|3702
ATGGCATCACCAACCATCGTCATCATTGGAGCTGGAGTCTTTGGACTGTCGTGTGCCGTCAATCTCCAGGCCAAG
CTCGCAGAGGAAGATGCCCTTGTCCGGCATGAGTTGGTGGTCGTTGCTTGCGAATGGCCATCACCGACTATTCCC
GGTCTATCGTCGCCATCGGTAAACTATGCCTCCATGTGGGCTGGGGCTCACGTTAGACCGATTCCCGCTACTACG
CCCCAGCTACAGCGCGAGGCCAAGTGGCTCAAGCACACGGTGGCCGAGTTCGAGCGCCAGATGGAAGCCGAGCCG
TTTTGCGGAATCACACGGACTGGTGGTATCGAGTACATGGAAGAGCCCTCGGCAGGCTATTCGAATCAAGACTCG
TCCACGTTTGAGCAGGAATCGGGCCTGCGAGGGTACGGCCAAATTGCAGGCTGCGAGCTTCCCGAAGGCGTAGCG
CTAGGCTTCCGCTACGAGACATTTTGTATCAACCCCTCGGTCTACTGTGAGCATCTGCTTCGCAAGTTTCTGCTC
AGGGGAGGAAAGGCGAAGACAAGGCATCTGTCCAGCGAGTGGGATCCCTATTCGGCGCTGGATCAAGTGGTGCTT
GTGATCAACGCGAGTGGCTTTGGCTTTGGCGACCCCCAATGCTTCCCAACCAGAGGTCAGACTGTGCTCACGGAT
CTCTCCGTGGCCTACACAATCACCAGACAACACAGAGACGGGACCAAAAGCTTCCTCGTGCCGCGGTCCTTTTGC
GGAGGAACGGTGGTGGGCGGGACCACAGAAGTCAGAGACTGGCGAGACGCCCCTGACGCGGCGACTAGAGACCGT
CTCCTGGCTTCCGGACTGGCCATGGCAGGCAGCCACGGACAGGTCAAAGTCGTTGGGGATATTGTCGGTCGCAGG
CCCACTCGTACAGACGGATTGAGATTGGATGTCGAGGAGAGGAGCAGGACGGAACGGGTAATACACGCCTACGGT
GCCGGGGGACGTGGCTATGAGATGAGTTGGGGGGTGGCTAACGAGGTGACGCAGCTGGCCATTCCATTGCTTCGT
Transcript >Ophio5|3702
ATGGCATCACCAACCATCGTCATCATTGGAGCTGGAGTCTTTGGACTGTCGTGTGCCGTCAATCTCCAGGCCAAG
CTCGCAGAGGAAGATGCCCTTGTCCGGCATGAGTTGGTGGTCGTTGCTTGCGAATGGCCATCACCGACTATTCCC
GGTCTATCGTCGCCATCGGTAAACTATGCCTCCATGTGGGCTGGGGCTCACGTTAGACCGATTCCCGCTACTACG
CCCCAGCTACAGCGCGAGGCCAAGTGGCTCAAGCACACGGTGGCCGAGTTCGAGCGCCAGATGGAAGCCGAGCCG
TTTTGCGGAATCACACGGACTGGTGGTATCGAGTACATGGAAGAGCCCTCGGCAGGCTATTCGAATCAAGACTCG
TCCACGTTTGAGCAGGAATCGGGCCTGCGAGGGTACGGCCAAATTGCAGGCTGCGAGCTTCCCGAAGGCGTAGCG
CTAGGCTTCCGCTACGAGACATTTTGTATCAACCCCTCGGTCTACTGTGAGCATCTGCTTCGCAAGTTTCTGCTC
AGGGGAGGAAAGGCGAAGACAAGGCATCTGTCCAGCGAGTGGGATCCCTATTCGGCGCTGGATCAAGTGGTGCTT
GTGATCAACGCGAGTGGCTTTGGCTTTGGCGACCCCCAATGCTTCCCAACCAGAGGTCAGACTGTGCTCACGGAT
CTCTCCGTGGCCTACACAATCACCAGACAACACAGAGACGGGACCAAAAGCTTCCTCGTGCCGCGGTCCTTTTGC
GGAGGAACGGTGGTGGGCGGGACCACAGAAGTCAGAGACTGGCGAGACGCCCCTGACGCGGCGACTAGAGACCGT
CTCCTGGCTTCCGGACTGGCCATGGCAGGCAGCCACGGACAGGTCAAAGTCGTTGGGGATATTGTCGGTCGCAGG
CCCACTCGTACAGACGGATTGAGATTGGATGTCGAGGAGAGGAGCAGGACGGAACGGGTAATACACGCCTACGGT
GCCGGGGGACGTGGCTATGAGATGAGTTGGGGGGTGGCTAACGAGGTGACGCAGCTGGCCATTCCATTGCTTCGT
TGA
Gene >Ophio5|3702
ATGGCATCACCAACCATCGTCATCATTGGGTGAGCAAAACACAAGTCTGATGAAAACGGCCTCGAGCTAAGCACC
GACATCATCAGAGCTGGAGTCTTTGGACTGTCGTGTGCCGTCAATCTCCAGGCCAAGCTCGCAGAGGAAGATGCC
CTTGTCCGGCATGAGTTGGTGGTCGTTGCTTGCGAATGGCCATCACCGACTATTCCCGGTCTATCGTCGCCATCG
GTAAACTATGCCTCCATGTGGGCTGGGGCTCACGTTAGACCGATTCCCGCTACTACGCCCCAGCTACAGCGCGAG
GCCAAGTGGCTCAAGCACACGGTGGCCGAGTTCGAGCGCCAGATGGAAGCCGAGCCGTTTTGCGGAATCACACGG
ACTGGTGGTATCGAGTACATGGAAGAGCCCTCGGCAGGCTATTCGAATCAAGACTCGTCCACGTTTGAGCAGGAA
TCGGGCCTGCGAGGGTACGGCCAAATTGCAGGCTGCGAGCTTCCCGAAGGCGTAGCGCTAGGCTTCCGCTACGAG
ACATTTTGTATCAACCCCTCGGTCTACTGTGAGCATCTGCTTCGCAAGTTTCTGCTCAGGGGAGGAAAGGCGAAG
ACAAGGCATCTGTCCAGCGAGTGGGATCCCTATTCGGCGCTGGATCAAGTGGTGCTTGTGATCAACGCGAGTGGC
TTTGGCTTTGGCGACCCCCAATGCTTCCCAACCAGAGGTTTGAACTTTGCATGCCATGGCACAATGCTTTGCTTC
TTGGCCAAAGGCTGACGACGCGAATGGCAGGTCAGACTGTGCTCACGGATCTCTCCGTGGCCTACACAATCACCA
GACAACACAGAGACGGGACCAAAAGCTTCCTCGTGCCGCGGTCCTTTTGCGGAGGAACGGTGGTGGGCGGGACCA
CAGAAGTCAGAGACTGGCGAGACGCCCCTGACGCGGCGACTAGAGACCGTCTCCTGGCTTCCGGACTGGCCATGG
CAGGCAGCCACGGACAGGTCAAAGTCGTTGGGGATATTGTCGGTCGCAGGCCCACTCGTACAGACGGATTGAGAT
TGGATGTCGAGGAGAGGAGCAGGACGGAACGGGTAATACACGCCTACGGTGCCGGGGGACGTGGCTATGAGATGA
GTTGGGGGGTGGCTAACGAGGTGACGCAGCTGGCCATTCCATTGCTTCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail