Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3701
Gene name
Locationscaffold_291:21736..23494
Strand+
Gene length (bp)1758
Transcript length (bp)1500
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.8E-32 56 424

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 11 497 7.0E-62
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 11 487 4.0E-61
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 36 477 1.0E-58
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 39 497 1.0E-54
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 43 491 1.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 11 497 7.0E-62
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 11 487 4.0E-61
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 36 477 1.0E-58
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 39 497 1.0E-54
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 43 491 1.0E-53
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 20 497 2.0E-39
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 3 497 8.0E-35
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 36 424 4.0E-34
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 36 424 5.0E-34
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 39 308 2.0E-33
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 41 247 3.0E-29
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 40 497 1.0E-28
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 9 489 2.0E-27
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 11 498 5.0E-26
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 39 254 9.0E-25
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 40 473 9.0E-24
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 28 469 6.0E-23
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 8 332 7.0E-23
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 8 497 7.0E-21
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 24 365 2.0E-20
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 40 489 2.0E-17
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 40 295 2.0E-15
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 40 370 3.0E-15
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 41 488 3.0E-14
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 36 425 5.0E-12
sp|Q0K843|SAUU_CUPNH Probable sulfoacetate transporter SauU OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauU PE=2 SV=1 42 246 2.0E-10
sp|O84548|UHPT_CHLTR Probable hexose phosphate transport protein OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_544 PE=3 SV=1 57 292 8.0E-08
sp|P39398|LGOT_ECOLI Probable L-galactonate transporter OS=Escherichia coli (strain K12) GN=lgoT PE=1 SV=2 36 258 1.0E-07
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 146 254 1.0E-07
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 32 275 2.0E-06
sp|Q9PJJ8|UHPT_CHLMU Probable hexose phosphate transport protein OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0831 PE=3 SV=1 59 336 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 49 68 19
2 88 110 22
3 117 139 22
4 143 165 22
5 178 200 22
6 210 232 22
7 285 307 22
8 322 341 19
9 348 365 17
10 375 397 22
11 409 428 19
12 438 460 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3701
MAEAQQPLKTEAQKPAHARHGVDAVKAVEHDLYQYDAAIERRLRLKIDLCVVPTVSLLYLFCFIDRANLGNAKIA
GLDVDLGMSGFDYNAVVSIFYISYILLEIPCNILCKWVGPGWFLPLAAVMFGVASVGTAFVTSIPQLMLVRFTLG
IFETGVMPGIAYYLSRWYRRAELAFRLSLYIVMAPIAGAFGGLLASAILSLESFAKLHSWRMIFAIEGIITITLG
FLAFFTLTDRPDTARWLTAEEKRLAIGRIKSERVTATVVLDKMDKTKLLRGLTCPVTLTTSFLFLLNNVTVQGLA
FFAPTIVKTIYSDRSLVQQQLYTVPPYVVGAFFTLLFPFVSWRLDRRLIFIILSAPLVIVGYCMFLGSQDHTVRY
AATFLVASSAFALGPLTNAHVSVNVVSDTARSAAIGMNVMMGNIGGLISSWSFLPFDAPNYHIGNGLNLATASTI
LLVATAMFYWQNQDNEKRRTRDAEAELGRLTQQQIEDLDWKHPDFRWKA
Coding >Ophio5|3701
ATGGCCGAGGCACAGCAACCGCTCAAGACGGAGGCACAAAAGCCTGCCCACGCCCGCCACGGTGTAGATGCCGTC
AAGGCTGTAGAGCACGACCTCTACCAATACGACGCCGCCATTGAGCGCCGACTCCGGCTCAAGATCGATCTCTGC
GTCGTTCCCACGGTATCATTACTCTATCTCTTTTGCTTCATTGACCGCGCCAACCTGGGCAATGCCAAGATCGCC
GGCCTTGATGTCGATCTCGGCATGAGCGGGTTCGACTACAATGCCGTCGTCTCCATCTTCTACATCTCCTACATC
CTGCTCGAGATCCCCTGCAACATCCTCTGTAAGTGGGTGGGCCCAGGCTGGTTCCTCCCCTTGGCGGCTGTCATG
TTCGGCGTCGCCTCGGTCGGCACCGCCTTCGTCACCAGTATTCCCCAGCTCATGCTGGTGCGCTTCACCCTCGGC
ATCTTTGAGACGGGCGTCATGCCTGGGATCGCGTATTATCTCTCGCGATGGTACCGCCGCGCCGAGCTCGCGTTC
CGTCTCTCGCTCTACATCGTCATGGCACCCATCGCCGGTGCTTTCGGTGGCCTTCTCGCATCGGCCATCCTGTCG
TTGGAGAGCTTTGCCAAACTGCATAGCTGGCGCATGATCTTCGCCATCGAGGGCATCATCACCATCACCCTCGGC
TTCCTCGCCTTCTTTACCCTCACCGACCGGCCTGATACAGCTCGTTGGTTGACGGCCGAGGAGAAGCGTCTAGCC
ATCGGCCGCATCAAATCAGAACGCGTTACCGCCACCGTCGTACTGGACAAGATGGACAAGACCAAGCTTCTTCGC
GGCTTGACCTGCCCTGTCACGCTCACGACCTCGTTTCTATTCCTCCTCAATAACGTCACCGTTCAGGGCCTGGCC
TTCTTCGCCCCCACCATCGTCAAGACCATCTACAGTGACCGGTCGCTGGTTCAGCAGCAGCTCTACACCGTACCC
CCTTATGTCGTCGGCGCCTTCTTCACTCTTCTCTTCCCATTTGTGAGCTGGCGTCTCGACAGACGGCTCATCTTC
ATCATTCTCTCGGCGCCCCTCGTCATCGTCGGTTACTGCATGTTCCTCGGCTCGCAGGATCACACCGTTCGTTAC
GCAGCCACCTTTCTCGTAGCATCGTCTGCCTTTGCCCTCGGGCCCCTGACCAACGCCCACGTGTCGGTCAACGTG
GTCAGCGACACGGCTCGAAGCGCCGCCATCGGTATGAACGTCATGATGGGCAATATCGGCGGACTCATCAGCTCC
TGGTCCTTTCTCCCCTTCGACGCCCCCAACTACCACATCGGCAACGGCCTGAACCTCGCTACCGCCAGCACCATC
CTCCTGGTCGCCACCGCCATGTTTTACTGGCAGAACCAGGACAATGAAAAGCGACGGACCCGCGACGCAGAGGCT
GAGCTTGGCCGTCTGACCCAGCAGCAGATTGAGGATCTGGACTGGAAACATCCCGACTTTCGGTGGAAGGCT
Transcript >Ophio5|3701
ATGGCCGAGGCACAGCAACCGCTCAAGACGGAGGCACAAAAGCCTGCCCACGCCCGCCACGGTGTAGATGCCGTC
AAGGCTGTAGAGCACGACCTCTACCAATACGACGCCGCCATTGAGCGCCGACTCCGGCTCAAGATCGATCTCTGC
GTCGTTCCCACGGTATCATTACTCTATCTCTTTTGCTTCATTGACCGCGCCAACCTGGGCAATGCCAAGATCGCC
GGCCTTGATGTCGATCTCGGCATGAGCGGGTTCGACTACAATGCCGTCGTCTCCATCTTCTACATCTCCTACATC
CTGCTCGAGATCCCCTGCAACATCCTCTGTAAGTGGGTGGGCCCAGGCTGGTTCCTCCCCTTGGCGGCTGTCATG
TTCGGCGTCGCCTCGGTCGGCACCGCCTTCGTCACCAGTATTCCCCAGCTCATGCTGGTGCGCTTCACCCTCGGC
ATCTTTGAGACGGGCGTCATGCCTGGGATCGCGTATTATCTCTCGCGATGGTACCGCCGCGCCGAGCTCGCGTTC
CGTCTCTCGCTCTACATCGTCATGGCACCCATCGCCGGTGCTTTCGGTGGCCTTCTCGCATCGGCCATCCTGTCG
TTGGAGAGCTTTGCCAAACTGCATAGCTGGCGCATGATCTTCGCCATCGAGGGCATCATCACCATCACCCTCGGC
TTCCTCGCCTTCTTTACCCTCACCGACCGGCCTGATACAGCTCGTTGGTTGACGGCCGAGGAGAAGCGTCTAGCC
ATCGGCCGCATCAAATCAGAACGCGTTACCGCCACCGTCGTACTGGACAAGATGGACAAGACCAAGCTTCTTCGC
GGCTTGACCTGCCCTGTCACGCTCACGACCTCGTTTCTATTCCTCCTCAATAACGTCACCGTTCAGGGCCTGGCC
TTCTTCGCCCCCACCATCGTCAAGACCATCTACAGTGACCGGTCGCTGGTTCAGCAGCAGCTCTACACCGTACCC
CCTTATGTCGTCGGCGCCTTCTTCACTCTTCTCTTCCCATTTGTGAGCTGGCGTCTCGACAGACGGCTCATCTTC
ATCATTCTCTCGGCGCCCCTCGTCATCGTCGGTTACTGCATGTTCCTCGGCTCGCAGGATCACACCGTTCGTTAC
GCAGCCACCTTTCTCGTAGCATCGTCTGCCTTTGCCCTCGGGCCCCTGACCAACGCCCACGTGTCGGTCAACGTG
GTCAGCGACACGGCTCGAAGCGCCGCCATCGGTATGAACGTCATGATGGGCAATATCGGCGGACTCATCAGCTCC
TGGTCCTTTCTCCCCTTCGACGCCCCCAACTACCACATCGGCAACGGCCTGAACCTCGCTACCGCCAGCACCATC
CTCCTGGTCGCCACCGCCATGTTTTACTGGCAGAACCAGGACAATGAAAAGCGACGGACCCGCGACGCAGAGGCT
GAGCTTGGCCGTCTGACCCAGCAGCAGATTGAGGATCTGGACTGGAAACATCCCGACTTTCGGTGGAAGGCTTGA
Gene >Ophio5|3701
ATGGCCGAGGCACAGCAACCGCTCAAGACGGAGGCACAAAAGCCTGCCCACGCCCGCCACGGTGTAGATGCCGTC
AAGGCTGTAGAGTGTGCCCCTATCGAGTACAAAACTATCTCCATAAAGAAAAGGGAGAAGGGGGGAAAGGGGGGA
GAGAGGGGGGGGGGGGGAGGGGGGGTAAACGGTGGCCTGCTTGGGAGTTGGCTGACTCTTTCGCAGGCACGACCT
CTACCAATACGACGCCGCCATTGAGCGCCGACTCCGGCTCAAGATCGATCTCTGCGTCGTTCCCACGGTATCATT
ACTCTATCTCTTTTGCTTCATTGACCGCGCCAACCTGGGTAAGCGACTTGTGCTCTCCAAGACAGATTTTTCATT
TGAACTCACACAGCTCGTCAGGCAATGCCAAGATCGCCGGCCTTGATGTCGATCTCGGCATGAGCGGGTTCGACT
ACAATGCCGTCGTCTCCATCTTCTACATCTCCTACATCCTGCTCGAGATCCCCTGCAACATCCTCTGTAAGTGGG
TGGGCCCAGGCTGGTTCCTCCCCTTGGCGGCTGTCATGTTCGGCGTCGCCTCGGTCGGCACCGCCTTCGTCACCA
GTATTCCCCAGCTCATGCTGGTGCGCTTCACCCTCGGCATCTTTGAGACGGGCGTCATGCCTGGGATCGCGTATT
ATCTCTCGCGATGGTACCGCCGCGCCGAGCTCGCGTTCCGTCTCTCGCTCTACATCGTCATGGTGTGTATGAATT
GCTTTCGTAGCTTTGTCGTGCTCCGACTTGGGCTAAAACCTGGTGGTGAATCATCAGGCACCCATCGCCGGTGCT
TTCGGTGGCCTTCTCGCATCGGCCATCCTGTCGTTGGAGAGCTTTGCCAAACTGCATAGCTGGCGCATGATCTTC
GCCATCGAGGGCATCATCACCATCACCCTCGGCTTCCTCGCCTTCTTTACCCTCACCGACCGGCCTGATACAGCT
CGTTGGTTGACGGCCGAGGAGAAGCGTCTAGCCATCGGCCGCATCAAATCAGAACGCGTTACCGCCACCGTCGTA
CTGGACAAGATGGACAAGACCAAGCTTCTTCGCGGCTTGACCTGCCCTGTCACGCTCACGACCTCGTTTCTATTC
CTCCTCAATAACGTCACCGTTCAGGGCCTGGCCTTCTTCGCCCCCACCATCGTCAAGACCATCTACAGTGACCGG
TCGCTGGTTCAGCAGCAGCTCTACACCGTACCCCCTTATGTCGTCGGCGCCTTCTTCACTCTTCTCTTCCCATTT
GTGAGCTGGCGTCTCGACAGACGGCTCATCTTCATCATTCTCTCGGCGCCCCTCGTCATCGTCGGTTACTGCATG
TTCCTCGGCTCGCAGGATCACACCGTTCGTTACGCAGCCACCTTTCTCGTAGCATCGTCTGCCTTTGCCCTCGGG
CCCCTGACCAACGCCCACGTGTCGGTCAACGTGGTCAGCGACACGGCTCGAAGCGCCGCCATCGGTATGAACGTC
ATGATGGGCAATATCGGCGGACTCATCAGCTCCTGGTCCTTTCTCCCCTTCGACGCCCCCAACTACCACATCGGC
AACGGCCTGAACCTCGCTACCGCCAGCACCATCCTCCTGGTCGCCACCGCCATGTTTTACTGGCAGAACCAGGAC
AATGAAAAGCGACGGACCCGCGACGCAGAGGCTGAGCTTGGCCGTCTGACCCAGCAGCAGATTGAGGATCTGGAC
TGGAAACATCCCGACTTTCGGTGGAAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail