Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3698
Gene name
Locationscaffold_291:15148..16138
Strand+
Gene length (bp)990
Transcript length (bp)915
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94348|YIP1_SCHPO Protein transport protein yip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip1 PE=3 SV=1 39 289 1.0E-64
sp|Q54QY3|YIPF5_DICDI Protein YIPF5 homolog OS=Dictyostelium discoideum GN=yipf5 PE=3 SV=1 82 287 4.0E-46
sp|Q7SXS2|YIPF5_XENLA Protein YIPF5 OS=Xenopus laevis GN=yipf5 PE=2 SV=1 20 287 3.0E-44
sp|Q6P5I8|YIPF5_DANRE Protein YIPF5 OS=Danio rerio GN=yipf5 PE=2 SV=1 85 287 1.0E-43
sp|P53039|YIP1_YEAST Protein transport protein YIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP1 PE=1 SV=1 72 287 1.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94348|YIP1_SCHPO Protein transport protein yip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip1 PE=3 SV=1 39 289 1.0E-64
sp|Q54QY3|YIPF5_DICDI Protein YIPF5 homolog OS=Dictyostelium discoideum GN=yipf5 PE=3 SV=1 82 287 4.0E-46
sp|Q7SXS2|YIPF5_XENLA Protein YIPF5 OS=Xenopus laevis GN=yipf5 PE=2 SV=1 20 287 3.0E-44
sp|Q6P5I8|YIPF5_DANRE Protein YIPF5 OS=Danio rerio GN=yipf5 PE=2 SV=1 85 287 1.0E-43
sp|P53039|YIP1_YEAST Protein transport protein YIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP1 PE=1 SV=1 72 287 1.0E-43
sp|Q66KA5|YIPF5_XENTR Protein YIPF5 OS=Xenopus tropicalis GN=yipf5 PE=2 SV=1 85 287 2.0E-43
sp|Q5R6W5|YIPF5_PONAB Protein YIPF5 OS=Pongo abelii GN=YIPF5 PE=2 SV=1 80 287 2.0E-42
sp|Q969M3|YIPF5_HUMAN Protein YIPF5 OS=Homo sapiens GN=YIPF5 PE=1 SV=1 80 287 2.0E-42
sp|Q4R5M4|YIPF5_MACFA Protein YIPF5 OS=Macaca fascicularis GN=YIPF5 PE=2 SV=1 80 287 2.0E-42
sp|Q5E9E8|YIPF5_BOVIN Protein YIPF5 OS=Bos taurus GN=YIPF5 PE=2 SV=1 80 287 4.0E-42
sp|Q8N8F6|YIPF7_HUMAN Protein YIPF7 OS=Homo sapiens GN=YIPF7 PE=2 SV=2 38 287 3.0E-40
sp|Q9JIM5|YIPF7_MOUSE Protein YIPF7 OS=Mus musculus GN=Yipf7 PE=2 SV=1 81 287 8.0E-40
sp|Q9EQQ2|YIPF5_MOUSE Protein YIPF5 OS=Mus musculus GN=Yipf5 PE=1 SV=1 95 287 4.0E-36
sp|Q5XID0|YIPF5_RAT Protein YIPF5 OS=Rattus norvegicus GN=Yipf5 PE=2 SV=1 95 287 5.0E-36
sp|A5D7K7|YIPF7_BOVIN Protein YIPF7 OS=Bos taurus GN=YIPF7 PE=2 SV=1 95 287 2.0E-33
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 126 143 17
2 148 170 22
3 210 229 19
4 239 261 22
5 268 287 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3698
MSNPYGNSANPPYGAAAAQNLQFYPSSYAPAVAASHQQQPPPYSYAASTPSGPSASGPGFGVSGRMGEQAGLRTG
WLAAFSTEGYDGEPPLWEELGINFRHIQKKTLAVLNPFRHIDQHLMDDSDLAGPILSFLLFGTFLLFSGKVHFGY
IYGLALLGSMSLHMILSLMSPSESQQQQASYHPQYSSDTSAQSSMQHGGHFSSTLTFSRSASVLGYCLLPLVVTS
LFGVGMPMDTPLGIVLTSAAIVWCTYSASGMFCAVGRMKGMRGLVAYPLALFYVGFGIIGIFSSRGSGSLAHAAA
KLNG
Coding >Ophio5|3698
ATGTCCAACCCCTACGGCAACAGCGCCAACCCGCCCTACGGAGCCGCGGCCGCTCAGAACCTACAGTTCTATCCC
TCCTCCTACGCGCCCGCCGTTGCCGCCTCTCATCAGCAGCAGCCGCCGCCCTATAGCTACGCCGCTTCTACACCC
AGCGGTCCGTCCGCCTCCGGTCCTGGCTTCGGCGTCTCGGGTCGTATGGGCGAGCAGGCCGGTCTGCGAACCGGA
TGGCTGGCTGCCTTTTCTACCGAGGGGTATGATGGTGAGCCGCCGCTGTGGGAGGAGCTCGGCATCAACTTTCGA
CACATTCAGAAAAAGACGCTGGCTGTCCTCAACCCCTTCCGCCACATCGATCAACATCTCATGGACGACTCCGAC
CTCGCCGGTCCCATCCTCTCCTTCCTCCTCTTCGGCACCTTTCTCCTCTTCTCCGGCAAGGTTCATTTCGGCTAC
ATATACGGCCTCGCCCTGCTCGGCTCCATGTCGCTACACATGATACTGTCGCTCATGTCGCCCTCGGAGTCGCAG
CAGCAGCAGGCCTCGTACCACCCGCAGTACAGCAGCGATACCTCGGCCCAGTCGTCCATGCAGCACGGCGGCCAC
TTCTCCTCGACACTCACCTTTTCCCGCTCCGCCTCCGTCCTCGGCTACTGCCTGTTGCCCCTCGTCGTCACCAGC
CTCTTCGGCGTCGGCATGCCCATGGATACGCCCCTCGGCATCGTCCTCACCAGCGCCGCCATAGTATGGTGCACC
TACAGCGCCAGCGGCATGTTCTGCGCCGTCGGCAGGATGAAGGGCATGCGAGGCCTCGTCGCCTACCCCCTCGCC
CTCTTCTACGTCGGCTTTGGCATCATCGGCATCTTTAGCAGCCGTGGCAGTGGATCTCTTGCTCATGCCGCTGCC
AAGTTGAATGGT
Transcript >Ophio5|3698
ATGTCCAACCCCTACGGCAACAGCGCCAACCCGCCCTACGGAGCCGCGGCCGCTCAGAACCTACAGTTCTATCCC
TCCTCCTACGCGCCCGCCGTTGCCGCCTCTCATCAGCAGCAGCCGCCGCCCTATAGCTACGCCGCTTCTACACCC
AGCGGTCCGTCCGCCTCCGGTCCTGGCTTCGGCGTCTCGGGTCGTATGGGCGAGCAGGCCGGTCTGCGAACCGGA
TGGCTGGCTGCCTTTTCTACCGAGGGGTATGATGGTGAGCCGCCGCTGTGGGAGGAGCTCGGCATCAACTTTCGA
CACATTCAGAAAAAGACGCTGGCTGTCCTCAACCCCTTCCGCCACATCGATCAACATCTCATGGACGACTCCGAC
CTCGCCGGTCCCATCCTCTCCTTCCTCCTCTTCGGCACCTTTCTCCTCTTCTCCGGCAAGGTTCATTTCGGCTAC
ATATACGGCCTCGCCCTGCTCGGCTCCATGTCGCTACACATGATACTGTCGCTCATGTCGCCCTCGGAGTCGCAG
CAGCAGCAGGCCTCGTACCACCCGCAGTACAGCAGCGATACCTCGGCCCAGTCGTCCATGCAGCACGGCGGCCAC
TTCTCCTCGACACTCACCTTTTCCCGCTCCGCCTCCGTCCTCGGCTACTGCCTGTTGCCCCTCGTCGTCACCAGC
CTCTTCGGCGTCGGCATGCCCATGGATACGCCCCTCGGCATCGTCCTCACCAGCGCCGCCATAGTATGGTGCACC
TACAGCGCCAGCGGCATGTTCTGCGCCGTCGGCAGGATGAAGGGCATGCGAGGCCTCGTCGCCTACCCCCTCGCC
CTCTTCTACGTCGGCTTTGGCATCATCGGCATCTTTAGCAGCCGTGGCAGTGGATCTCTTGCTCATGCCGCTGCC
AAGTTGAATGGTTGA
Gene >Ophio5|3698
ATGTCCAACCCCTACGGCAACAGCGCCAACCCGCCCTACGGAGCCGCGGCCGCTCAGAACCTACAGTTCTATCCC
TCCTCCTACGCGCCCGCCGTTGCCGCCTCTCATCAGCAGCAGCCGCCGCCCTATAGCTACGCCGCTTCTACACCC
AGCGGTCCGTCCGCCTCCGGTCCTGGCTTCGGCGTCTCGGGTCGTATGGGCGAGCAGGCCGGTCTGCGAACCGGA
TGGCTGGCTGCCTTTTCTACCGAGGGGTATGATGGTGAGCCGCCGCTGTGGGAGGAGCTCGGCATCAACTTTCGA
CACATTCAGAAAAAGGTGCCGCCCTCTTTTCCTCCCCATCTTGTTCACCCTCTCTTGCTTTCCCCCTTCACTGCT
AAGGTAGATACGCAGACGCTGGCTGTCCTCAACCCCTTCCGCCACATCGATCAACATCTCATGGACGACTCCGAC
CTCGCCGGTCCCATCCTCTCCTTCCTCCTCTTCGGCACCTTTCTCCTCTTCTCCGGCAAGGTTCATTTCGGCTAC
ATATACGGCCTCGCCCTGCTCGGCTCCATGTCGCTACACATGATACTGTCGCTCATGTCGCCCTCGGAGTCGCAG
CAGCAGCAGGCCTCGTACCACCCGCAGTACAGCAGCGATACCTCGGCCCAGTCGTCCATGCAGCACGGCGGCCAC
TTCTCCTCGACACTCACCTTTTCCCGCTCCGCCTCCGTCCTCGGCTACTGCCTGTTGCCCCTCGTCGTCACCAGC
CTCTTCGGCGTCGGCATGCCCATGGATACGCCCCTCGGCATCGTCCTCACCAGCGCCGCCATAGTATGGTGCACC
TACAGCGCCAGCGGCATGTTCTGCGCCGTCGGCAGGATGAAGGGCATGCGAGGCCTCGTCGCCTACCCCCTCGCC
CTCTTCTACGTCGGCTTTGGCATCATCGGCATCTTTAGCAGCCGTGGCAGTGGATCTCTTGCTCATGCCGCTGCC
AAGTTGAATGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail