Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3698
Gene name
Locationscaffold_291:15148..16138
Strand+
Gene length (bp)990
Transcript length (bp)915
Coding sequence length (bp)912
Protein length (aa) 304

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94348|YIP1_SCHPO Protein transport protein yip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip1 PE=3 SV=1 39 289 1.0E-64
sp|Q54QY3|YIPF5_DICDI Protein YIPF5 homolog OS=Dictyostelium discoideum GN=yipf5 PE=3 SV=1 82 287 4.0E-46
sp|Q7SXS2|YIPF5_XENLA Protein YIPF5 OS=Xenopus laevis GN=yipf5 PE=2 SV=1 20 287 3.0E-44
sp|Q6P5I8|YIPF5_DANRE Protein YIPF5 OS=Danio rerio GN=yipf5 PE=2 SV=1 85 287 1.0E-43
sp|P53039|YIP1_YEAST Protein transport protein YIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP1 PE=1 SV=1 72 287 1.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94348|YIP1_SCHPO Protein transport protein yip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip1 PE=3 SV=1 39 289 1.0E-64
sp|Q54QY3|YIPF5_DICDI Protein YIPF5 homolog OS=Dictyostelium discoideum GN=yipf5 PE=3 SV=1 82 287 4.0E-46
sp|Q7SXS2|YIPF5_XENLA Protein YIPF5 OS=Xenopus laevis GN=yipf5 PE=2 SV=1 20 287 3.0E-44
sp|Q6P5I8|YIPF5_DANRE Protein YIPF5 OS=Danio rerio GN=yipf5 PE=2 SV=1 85 287 1.0E-43
sp|P53039|YIP1_YEAST Protein transport protein YIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP1 PE=1 SV=1 72 287 1.0E-43
sp|Q66KA5|YIPF5_XENTR Protein YIPF5 OS=Xenopus tropicalis GN=yipf5 PE=2 SV=1 85 287 2.0E-43
sp|Q5R6W5|YIPF5_PONAB Protein YIPF5 OS=Pongo abelii GN=YIPF5 PE=2 SV=1 80 287 2.0E-42
sp|Q969M3|YIPF5_HUMAN Protein YIPF5 OS=Homo sapiens GN=YIPF5 PE=1 SV=1 80 287 2.0E-42
sp|Q4R5M4|YIPF5_MACFA Protein YIPF5 OS=Macaca fascicularis GN=YIPF5 PE=2 SV=1 80 287 2.0E-42
sp|Q5E9E8|YIPF5_BOVIN Protein YIPF5 OS=Bos taurus GN=YIPF5 PE=2 SV=1 80 287 4.0E-42
sp|Q8N8F6|YIPF7_HUMAN Protein YIPF7 OS=Homo sapiens GN=YIPF7 PE=2 SV=2 38 287 3.0E-40
sp|Q9JIM5|YIPF7_MOUSE Protein YIPF7 OS=Mus musculus GN=Yipf7 PE=2 SV=1 81 287 8.0E-40
sp|Q9EQQ2|YIPF5_MOUSE Protein YIPF5 OS=Mus musculus GN=Yipf5 PE=1 SV=1 95 287 4.0E-36
sp|Q5XID0|YIPF5_RAT Protein YIPF5 OS=Rattus norvegicus GN=Yipf5 PE=2 SV=1 95 287 5.0E-36
sp|A5D7K7|YIPF7_BOVIN Protein YIPF7 OS=Bos taurus GN=YIPF7 PE=2 SV=1 95 287 2.0E-33
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Golgi apparatus Signal peptide|Transmembrane domain 0.0653 0.1862 0.0341 0.1987 0.1344 0.1265 0.8678 0.4917 0.8621 0.0125

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 126 143 17
2 148 170 22
3 210 229 19
4 239 261 22
5 268 287 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4376
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4718
Ophiocordyceps australis map64 (Brazil) OphauB2|4569
Ophiocordyceps camponoti-floridani Ophcf2|01661
Ophiocordyceps camponoti-rufipedis Ophun1|4934
Ophiocordyceps kimflemingae Ophio5|3698 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9042

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3698
MSNPYGNSANPPYGAAAAQNLQFYPSSYAPAVAASHQQQPPPYSYAASTPSGPSASGPGFGVSGRMGEQAGLRTG
WLAAFSTEGYDGEPPLWEELGINFRHIQKKTLAVLNPFRHIDQHLMDDSDLAGPILSFLLFGTFLLFSGKVHFGY
IYGLALLGSMSLHMILSLMSPSESQQQQASYHPQYSSDTSAQSSMQHGGHFSSTLTFSRSASVLGYCLLPLVVTS
LFGVGMPMDTPLGIVLTSAAIVWCTYSASGMFCAVGRMKGMRGLVAYPLALFYVGFGIIGIFSSRGSGSLAHAAA
KLNG
Coding >Ophio5|3698
ATGTCCAACCCCTACGGCAACAGCGCCAACCCGCCCTACGGAGCCGCGGCCGCTCAGAACCTACAGTTCTATCCC
TCCTCCTACGCGCCCGCCGTTGCCGCCTCTCATCAGCAGCAGCCGCCGCCCTATAGCTACGCCGCTTCTACACCC
AGCGGTCCGTCCGCCTCCGGTCCTGGCTTCGGCGTCTCGGGTCGTATGGGCGAGCAGGCCGGTCTGCGAACCGGA
TGGCTGGCTGCCTTTTCTACCGAGGGGTATGATGGTGAGCCGCCGCTGTGGGAGGAGCTCGGCATCAACTTTCGA
CACATTCAGAAAAAGACGCTGGCTGTCCTCAACCCCTTCCGCCACATCGATCAACATCTCATGGACGACTCCGAC
CTCGCCGGTCCCATCCTCTCCTTCCTCCTCTTCGGCACCTTTCTCCTCTTCTCCGGCAAGGTTCATTTCGGCTAC
ATATACGGCCTCGCCCTGCTCGGCTCCATGTCGCTACACATGATACTGTCGCTCATGTCGCCCTCGGAGTCGCAG
CAGCAGCAGGCCTCGTACCACCCGCAGTACAGCAGCGATACCTCGGCCCAGTCGTCCATGCAGCACGGCGGCCAC
TTCTCCTCGACACTCACCTTTTCCCGCTCCGCCTCCGTCCTCGGCTACTGCCTGTTGCCCCTCGTCGTCACCAGC
CTCTTCGGCGTCGGCATGCCCATGGATACGCCCCTCGGCATCGTCCTCACCAGCGCCGCCATAGTATGGTGCACC
TACAGCGCCAGCGGCATGTTCTGCGCCGTCGGCAGGATGAAGGGCATGCGAGGCCTCGTCGCCTACCCCCTCGCC
CTCTTCTACGTCGGCTTTGGCATCATCGGCATCTTTAGCAGCCGTGGCAGTGGATCTCTTGCTCATGCCGCTGCC
AAGTTGAATGGT
Transcript >Ophio5|3698
ATGTCCAACCCCTACGGCAACAGCGCCAACCCGCCCTACGGAGCCGCGGCCGCTCAGAACCTACAGTTCTATCCC
TCCTCCTACGCGCCCGCCGTTGCCGCCTCTCATCAGCAGCAGCCGCCGCCCTATAGCTACGCCGCTTCTACACCC
AGCGGTCCGTCCGCCTCCGGTCCTGGCTTCGGCGTCTCGGGTCGTATGGGCGAGCAGGCCGGTCTGCGAACCGGA
TGGCTGGCTGCCTTTTCTACCGAGGGGTATGATGGTGAGCCGCCGCTGTGGGAGGAGCTCGGCATCAACTTTCGA
CACATTCAGAAAAAGACGCTGGCTGTCCTCAACCCCTTCCGCCACATCGATCAACATCTCATGGACGACTCCGAC
CTCGCCGGTCCCATCCTCTCCTTCCTCCTCTTCGGCACCTTTCTCCTCTTCTCCGGCAAGGTTCATTTCGGCTAC
ATATACGGCCTCGCCCTGCTCGGCTCCATGTCGCTACACATGATACTGTCGCTCATGTCGCCCTCGGAGTCGCAG
CAGCAGCAGGCCTCGTACCACCCGCAGTACAGCAGCGATACCTCGGCCCAGTCGTCCATGCAGCACGGCGGCCAC
TTCTCCTCGACACTCACCTTTTCCCGCTCCGCCTCCGTCCTCGGCTACTGCCTGTTGCCCCTCGTCGTCACCAGC
CTCTTCGGCGTCGGCATGCCCATGGATACGCCCCTCGGCATCGTCCTCACCAGCGCCGCCATAGTATGGTGCACC
TACAGCGCCAGCGGCATGTTCTGCGCCGTCGGCAGGATGAAGGGCATGCGAGGCCTCGTCGCCTACCCCCTCGCC
CTCTTCTACGTCGGCTTTGGCATCATCGGCATCTTTAGCAGCCGTGGCAGTGGATCTCTTGCTCATGCCGCTGCC
AAGTTGAATGGTTGA
Gene >Ophio5|3698
ATGTCCAACCCCTACGGCAACAGCGCCAACCCGCCCTACGGAGCCGCGGCCGCTCAGAACCTACAGTTCTATCCC
TCCTCCTACGCGCCCGCCGTTGCCGCCTCTCATCAGCAGCAGCCGCCGCCCTATAGCTACGCCGCTTCTACACCC
AGCGGTCCGTCCGCCTCCGGTCCTGGCTTCGGCGTCTCGGGTCGTATGGGCGAGCAGGCCGGTCTGCGAACCGGA
TGGCTGGCTGCCTTTTCTACCGAGGGGTATGATGGTGAGCCGCCGCTGTGGGAGGAGCTCGGCATCAACTTTCGA
CACATTCAGAAAAAGGTGCCGCCCTCTTTTCCTCCCCATCTTGTTCACCCTCTCTTGCTTTCCCCCTTCACTGCT
AAGGTAGATACGCAGACGCTGGCTGTCCTCAACCCCTTCCGCCACATCGATCAACATCTCATGGACGACTCCGAC
CTCGCCGGTCCCATCCTCTCCTTCCTCCTCTTCGGCACCTTTCTCCTCTTCTCCGGCAAGGTTCATTTCGGCTAC
ATATACGGCCTCGCCCTGCTCGGCTCCATGTCGCTACACATGATACTGTCGCTCATGTCGCCCTCGGAGTCGCAG
CAGCAGCAGGCCTCGTACCACCCGCAGTACAGCAGCGATACCTCGGCCCAGTCGTCCATGCAGCACGGCGGCCAC
TTCTCCTCGACACTCACCTTTTCCCGCTCCGCCTCCGTCCTCGGCTACTGCCTGTTGCCCCTCGTCGTCACCAGC
CTCTTCGGCGTCGGCATGCCCATGGATACGCCCCTCGGCATCGTCCTCACCAGCGCCGCCATAGTATGGTGCACC
TACAGCGCCAGCGGCATGTTCTGCGCCGTCGGCAGGATGAAGGGCATGCGAGGCCTCGTCGCCTACCCCCTCGCC
CTCTTCTACGTCGGCTTTGGCATCATCGGCATCTTTAGCAGCCGTGGCAGTGGATCTCTTGCTCATGCCGCTGCC
AAGTTGAATGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail