Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3695
Gene name
Locationscaffold_291:10354..11423
Strand-
Gene length (bp)1069
Transcript length (bp)996
Coding sequence length (bp)993
Protein length (aa) 331

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 4.6E-29 14 274
PF13460 NAD_binding_10 NAD(P)H-binding 1.2E-10 18 102
PF01370 Epimerase NAD dependent epimerase/dehydratase family 2.3E-05 14 77

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0VCN1|NMRL1_BOVIN NmrA-like family domain-containing protein 1 OS=Bos taurus GN=NMRAL1 PE=2 SV=1 8 242 4.0E-20
sp|Q5ZID0|NMRL1_CHICK NmrA-like family domain-containing protein 1 OS=Gallus gallus GN=NMRAL1 PE=2 SV=1 8 194 4.0E-19
sp|Q8K2T1|NMRL1_MOUSE NmrA-like family domain-containing protein 1 OS=Mus musculus GN=Nmral1 PE=1 SV=1 12 242 1.0E-18
sp|Q9HBL8|NMRL1_HUMAN NmrA-like family domain-containing protein 1 OS=Homo sapiens GN=NMRAL1 PE=1 SV=1 8 254 6.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3695
MSSSPRLMDAAKFVCVVGATGNQGGSVARRFLHAGFRVRALTRKPSSASASALAALGADIVEADLDDAGSLHRAF
AGAAIIFTVTNYWEPFFRDDCRDEARARGVSCRRYAGDVERQQGVNMADAAAATVATLEENGFIVSTLSHAGHCS
RGRISELYHFDAKADVFPGYVREAHPTLAAKMSCVHTGYFFTSFALLPRSYFAKTTDGTIEMAFPTSASKPVPHL
DPVGDMGNFVYAVRQMPPGRAYMAAGTTCPWPDFLSTWGRVAGYRVCYREVSSEEMVQATPDAEMGLEVALMFAY
SSDPGYDGGMALLTADDIRAVSGRPPSPTPS
Coding >Ophio5|3695
ATGTCCTCGTCGCCAAGATTGATGGACGCCGCCAAGTTTGTCTGCGTCGTCGGCGCTACCGGCAACCAAGGCGGC
TCCGTCGCCCGACGCTTCCTCCACGCCGGCTTCCGAGTACGGGCCTTGACACGGAAGCCATCTTCGGCCTCGGCC
TCGGCCCTCGCCGCGCTGGGGGCCGACATAGTCGAGGCCGACCTGGACGACGCGGGCAGTCTTCATCGGGCATTT
GCGGGCGCAGCCATCATCTTCACCGTCACCAATTACTGGGAGCCCTTCTTCCGCGACGATTGTCGCGATGAGGCG
CGGGCCCGAGGCGTTTCGTGTCGGCGATATGCTGGCGACGTGGAGAGGCAGCAGGGCGTGAACATGGCGGATGCT
GCCGCTGCTACGGTTGCTACGCTCGAGGAGAATGGCTTCATCGTCTCGACCTTGAGCCATGCTGGCCATTGCAGT
CGTGGTCGGATAAGCGAGCTTTACCATTTTGACGCAAAAGCCGATGTCTTCCCTGGCTACGTGCGTGAGGCGCAT
CCGACGCTGGCGGCCAAGATGTCGTGCGTTCATACGGGCTACTTCTTCACCAGCTTTGCTCTTTTGCCGCGCTCG
TACTTTGCCAAGACGACCGACGGCACTATCGAGATGGCCTTTCCCACGTCGGCATCCAAGCCGGTACCTCATCTG
GACCCCGTCGGCGACATGGGAAACTTCGTCTACGCCGTCAGACAGATGCCGCCCGGACGCGCCTACATGGCAGCC
GGTACCACCTGTCCCTGGCCCGACTTCCTATCGACATGGGGACGCGTAGCCGGCTACCGAGTATGCTATCGCGAG
GTCTCTTCCGAGGAGATGGTGCAGGCGACGCCGGACGCCGAAATGGGCCTCGAGGTCGCCCTCATGTTTGCCTAT
TCGTCTGATCCGGGCTACGACGGGGGCATGGCGCTGCTGACGGCTGACGATATCCGAGCGGTGAGTGGAAGGCCC
CCCTCCCCCACCCCCAGC
Transcript >Ophio5|3695
ATGTCCTCGTCGCCAAGATTGATGGACGCCGCCAAGTTTGTCTGCGTCGTCGGCGCTACCGGCAACCAAGGCGGC
TCCGTCGCCCGACGCTTCCTCCACGCCGGCTTCCGAGTACGGGCCTTGACACGGAAGCCATCTTCGGCCTCGGCC
TCGGCCCTCGCCGCGCTGGGGGCCGACATAGTCGAGGCCGACCTGGACGACGCGGGCAGTCTTCATCGGGCATTT
GCGGGCGCAGCCATCATCTTCACCGTCACCAATTACTGGGAGCCCTTCTTCCGCGACGATTGTCGCGATGAGGCG
CGGGCCCGAGGCGTTTCGTGTCGGCGATATGCTGGCGACGTGGAGAGGCAGCAGGGCGTGAACATGGCGGATGCT
GCCGCTGCTACGGTTGCTACGCTCGAGGAGAATGGCTTCATCGTCTCGACCTTGAGCCATGCTGGCCATTGCAGT
CGTGGTCGGATAAGCGAGCTTTACCATTTTGACGCAAAAGCCGATGTCTTCCCTGGCTACGTGCGTGAGGCGCAT
CCGACGCTGGCGGCCAAGATGTCGTGCGTTCATACGGGCTACTTCTTCACCAGCTTTGCTCTTTTGCCGCGCTCG
TACTTTGCCAAGACGACCGACGGCACTATCGAGATGGCCTTTCCCACGTCGGCATCCAAGCCGGTACCTCATCTG
GACCCCGTCGGCGACATGGGAAACTTCGTCTACGCCGTCAGACAGATGCCGCCCGGACGCGCCTACATGGCAGCC
GGTACCACCTGTCCCTGGCCCGACTTCCTATCGACATGGGGACGCGTAGCCGGCTACCGAGTATGCTATCGCGAG
GTCTCTTCCGAGGAGATGGTGCAGGCGACGCCGGACGCCGAAATGGGCCTCGAGGTCGCCCTCATGTTTGCCTAT
TCGTCTGATCCGGGCTACGACGGGGGCATGGCGCTGCTGACGGCTGACGATATCCGAGCGGTGAGTGGAAGGCCC
CCCTCCCCCACCCCCAGCTGA
Gene >Ophio5|3695
ATGTCCTCGTCGCCAAGATTGATGGACGCCGCCAAGTTTGTCTGCGTCGTCGGCGCTACCGGCAACCAAGGCGGC
TCCGTCGCCCGACGCTTCCTCCACGCCGGCTTCCGAGTACGGGCCTTGACACGGAAGCCATCTTCGGCCTCGGCC
TCGGCCCTCGCCGCGCTGGGGGCCGACATAGTCGAGGCCGACCTGGACGACGCGGGCAGTCTTCATCGGGCATTT
GCGGGCGCAGCCATCATCTTCACCGTCACCAATTACTGGGAGCCCTTCTTCCGCGACGATTGTCGCGATGAGGCG
CGGGCCCGAGGCGTTTCGTGTCGGCGATATGCTGGCGACGTGGAGAGGCAGCAGGGCGTGAACATGGCGGATGCT
GCCGCTGCTACGGTTGCTACGCTCGAGGAGAATGGCTTCATCGTCTCGACCTTGAGCCATGCTGGCCATTGCAGT
CGTGGTCGGATAAGCGAGCTTTACCATTTTGACGCAAAAGCCGATGTCTTCCCTGGCTACGTGCGTGAGGCGCAT
CCGACGCTGGCGGCCAAGATGTCGTGCGTTCATACGGGCTACTTCTTCACCAGCTTTGCTCTTTTGCCGCGCTCG
TACTTTGCCAAGGTGAGTCGATTTCGTCTGCCCATCCAAACCCATTCTCATCTCATCTGCCCGATCTGTTGCGAA
ACCTCGCAAGACGACCGACGGCACTATCGAGATGGCCTTTCCCACGTCGGCATCCAAGCCGGTACCTCATCTGGA
CCCCGTCGGCGACATGGGAAACTTCGTCTACGCCGTCAGACAGATGCCGCCCGGACGCGCCTACATGGCAGCCGG
TACCACCTGTCCCTGGCCCGACTTCCTATCGACATGGGGACGCGTAGCCGGCTACCGAGTATGCTATCGCGAGGT
CTCTTCCGAGGAGATGGTGCAGGCGACGCCGGACGCCGAAATGGGCCTCGAGGTCGCCCTCATGTTTGCCTATTC
GTCTGATCCGGGCTACGACGGGGGCATGGCGCTGCTGACGGCTGACGATATCCGAGCGGTGAGTGGAAGGCCCCC
CTCCCCCACCCCCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail