Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3685
Gene name
Locationscaffold_290:11453..15612
Strand+
Gene length (bp)4159
Transcript length (bp)4056
Coding sequence length (bp)4053
Protein length (aa) 1351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10441 Urb2 Urb2/Npa2 family 7.6E-57 1142 1350

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P47108|URB2_YEAST Nucleolar pre-ribosomal-associated protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URB2 PE=1 SV=1 1144 1348 4.0E-14

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2857 0.8611 0.4948 0.0312 0.0369 0.0227 0.1077 0.0127 0.0738 0.0427

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4161
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3299
Ophiocordyceps australis map64 (Brazil) OphauB2|4139
Ophiocordyceps camponoti-floridani Ophcf2|04447
Ophiocordyceps camponoti-rufipedis Ophun1|1769
Ophiocordyceps kimflemingae Ophio5|3685 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8448

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3685
MTDLIKTVRGIDHTGPGKNGEGLQRLWSCLAASSGRHFHAAEGSTLRWLLKSMNGTSAAAETVRRYPLTWTILAC
VFQRVPLFSLAKSLADRKFITVLQKTFKDISKPVTGSSSPASSKRKRNPPVGYDLNQLQDRQGCLETATELFKAL
QLLLGRLESPEAAFSRHQMGAEHIKSLFCTSAAEAVKIVAPALTVCDDLLISEPCDDSRGYESWISIVSLVWDLH
LQGNDDAVEVANHLFPSSAIILARVSNFASNMEANISDFLRNRWSADLRLFMHQNLIGPGRRDFTRHKVLEPFLR
ALGASKNIIQVAAPTLYLLCTDGPGPISEGELRKEDVEWLRRIFNAVEHAIAEQPDRSHIIQIVLDRAARRPTSV
DVDDLRRVCRRFALHESGTDWPLVAKVIACDSDVLLVSEEGHALRADICDRILKTGSGSAHDCVIPTVIRVIMEG
FRTRRALPSFLQFWFEQLCQEERQRDGQSLRWSTVGHLLNSTQPPSPILETELSPTQLLGIISWVETQATELHPQ
SICIFASTIALALRSESFVDAVGQRLLDLVASVDGSKPASALKWRVVSQTMNWAPPSERIHMWNSVKKQLTKTLK
KSPVVSSVTFEAFKCCLQAWDCMSLAAQADEPALLLENFSARLVAHDLGALVVDDKLKLPFTEKSTNGDFSEDCA
LQHYLMWCTYGSSRFIRLQFARNGDLPPVLSNALSIQDAPVEQVEMLWDAMLRNEINLNDIQLATTFVDRLVVAL
DGAVKVKSTGPEDQSLTWIKLLANIPIEVFSRGQREKLMNIINKQRATMAQSDQASLHAWKMVLSFATKMMRRPT
FYLDMSFSDLVELATAISGISIDCSSGCETTLELIERFLSMASATIRQMADHLDERGVNYFRGASEFVSDCKTRL
LTVANASTAEFGLFITLLRALVGEFSRTPNLRSHEELASLAVDSKAVLQRCVAATMSKFISDKKLPSASSSAADM
SLLSALDAASMFGSFGELLEPKSSAVQKFDKYTKQQMQQGDLRAWKIQAFLQAYLPATMALSRPTTYDSLADLPV
RLQHSLLKELVTSITGHMDCRERRHYLGELIGELGKGWDTDGQILAIQTVVDQLTDSFDQHEKTDGFSLAGAHSE
LTLSLLLLPKSPQAMRICHALQTLLESRPQAMGQWNIEITLSAVCDLSSMSSDESAVPFASLCKLVETVIKRHRL
RLEGHYHVLLSALQALLRDLIIRQSTGSDYGNGPEPKAQAYSRLISLICEPTTGAVSRTQLHGALESATDAAKRS
AGRHMYLIMMQYVKLQLQTSVPKAVSGALEPAMNAIFDITPPEVRKILNDAVQGGGRAILREMFRRYVKFGKWSG
V
Coding >Ophio5|3685
ATGACGGATCTCATCAAGACCGTGCGAGGCATCGATCATACCGGACCTGGAAAGAATGGCGAGGGCTTGCAGCGC
CTCTGGAGCTGTCTGGCAGCATCATCTGGACGCCACTTTCATGCCGCCGAAGGGAGCACCTTGAGATGGCTTCTA
AAATCCATGAACGGGACATCTGCGGCTGCCGAGACTGTCCGCCGTTACCCCTTGACATGGACCATCCTGGCCTGC
GTATTTCAACGGGTTCCCCTCTTCTCTCTCGCCAAGTCGCTTGCCGATCGAAAGTTCATCACCGTGCTGCAAAAA
ACATTCAAGGACATCTCCAAGCCTGTCACTGGCTCTTCTTCCCCGGCCTCGTCGAAGCGCAAAAGAAACCCGCCT
GTCGGCTACGACTTGAACCAGTTGCAAGACCGTCAAGGATGCCTAGAAACCGCCACGGAGCTTTTCAAGGCTTTG
CAGTTGCTTCTGGGACGCCTTGAAAGCCCAGAAGCGGCATTCTCCCGACACCAAATGGGCGCCGAACACATCAAG
TCTCTGTTTTGCACATCGGCAGCCGAAGCAGTCAAAATCGTGGCCCCGGCATTGACGGTTTGCGACGACTTGCTG
ATCAGTGAACCGTGCGATGACTCGAGAGGCTACGAATCCTGGATAAGCATCGTCTCGCTGGTTTGGGATCTCCAT
CTCCAAGGCAACGATGATGCAGTAGAGGTCGCGAACCATCTGTTTCCGTCATCAGCGATCATTCTGGCCAGGGTC
AGTAATTTTGCTTCCAATATGGAAGCCAACATTTCCGATTTCTTAAGAAATAGATGGAGTGCCGATCTGCGTCTC
TTTATGCACCAAAACCTCATCGGTCCTGGGAGGAGAGACTTCACCAGACATAAAGTCTTGGAACCCTTTCTCCGG
GCGCTGGGCGCATCGAAAAACATCATTCAAGTCGCAGCCCCTACTTTGTACCTTCTCTGCACGGATGGCCCTGGT
CCTATTTCCGAGGGCGAACTCCGGAAAGAAGACGTGGAATGGCTCAGACGGATATTCAATGCTGTGGAGCATGCC
ATCGCGGAGCAGCCTGATCGGAGCCACATCATTCAGATTGTTCTGGACAGGGCGGCACGGCGACCTACCTCGGTG
GATGTGGACGACCTGCGCCGTGTTTGTCGTCGTTTTGCTTTGCACGAGTCGGGGACGGACTGGCCGTTGGTGGCC
AAAGTGATTGCCTGCGACTCCGACGTCCTCCTGGTGTCTGAGGAGGGGCATGCACTGAGAGCAGACATCTGTGAC
CGAATACTGAAGACGGGGTCCGGAAGTGCACACGACTGTGTCATCCCGACCGTCATCAGGGTGATTATGGAGGGT
TTTCGAACGCGTCGTGCTCTGCCCAGCTTCTTGCAGTTCTGGTTCGAACAGCTTTGCCAGGAGGAGCGGCAACGA
GACGGCCAATCTTTGCGTTGGTCGACAGTTGGCCACCTACTCAATTCAACGCAACCTCCGAGCCCCATCCTTGAG
ACAGAATTATCACCGACACAACTTCTTGGCATCATTTCCTGGGTTGAAACGCAGGCGACGGAGCTGCATCCACAA
TCCATTTGCATATTCGCGAGCACTATCGCACTCGCACTTCGAAGCGAGTCCTTTGTCGACGCTGTGGGACAAAGG
CTTCTAGACTTGGTCGCCTCCGTGGACGGCTCTAAACCTGCTTCGGCTTTGAAGTGGAGGGTCGTTTCCCAGACA
ATGAACTGGGCACCTCCGAGTGAGAGGATCCATATGTGGAACTCGGTCAAGAAACAATTGACGAAGACGTTGAAG
AAATCACCTGTCGTCTCAAGCGTCACCTTCGAGGCGTTCAAATGCTGCCTTCAGGCTTGGGACTGTATGAGCCTG
GCAGCGCAGGCAGACGAGCCTGCCCTCCTCCTGGAGAATTTTTCTGCACGATTAGTTGCGCACGATCTCGGCGCA
CTTGTCGTGGACGACAAATTGAAGCTACCGTTTACAGAAAAAAGTACGAATGGAGACTTTTCAGAAGACTGCGCC
CTTCAACATTACTTGATGTGGTGCACATATGGATCGAGCAGATTCATCAGGCTTCAATTTGCGAGGAACGGAGAC
CTTCCACCAGTTTTGTCAAACGCGTTGTCGATTCAGGACGCGCCTGTGGAACAAGTCGAAATGCTCTGGGACGCC
ATGCTACGCAACGAAATCAACCTAAATGATATACAACTCGCGACGACCTTTGTCGACCGTCTCGTGGTTGCACTA
GACGGCGCTGTCAAGGTCAAGTCGACCGGCCCAGAAGACCAAAGCCTGACTTGGATCAAACTCTTGGCCAACATA
CCGATTGAGGTTTTTAGTCGCGGGCAACGAGAGAAGCTCATGAACATCATCAACAAGCAGCGAGCGACGATGGCT
CAGTCTGATCAGGCGTCTCTCCACGCCTGGAAAATGGTCCTCAGTTTCGCAACAAAGATGATGAGACGGCCCACG
TTCTATCTTGACATGAGCTTTTCAGACCTTGTTGAGCTTGCGACAGCAATTTCTGGCATCTCCATTGACTGCTCG
TCAGGTTGTGAGACTACCCTGGAACTGATAGAGAGGTTTCTCTCAATGGCGTCGGCAACGATTAGGCAGATGGCA
GATCACCTGGATGAACGAGGCGTCAATTACTTTCGCGGGGCTTCCGAATTCGTGTCTGATTGCAAGACACGGCTT
CTCACCGTGGCAAATGCCAGCACAGCCGAATTTGGCCTTTTCATAACTCTTTTGAGGGCTCTGGTGGGCGAGTTT
TCGCGAACACCGAATCTGCGAAGCCATGAGGAACTGGCCTCGCTAGCAGTCGATTCCAAAGCGGTCCTGCAGCGT
TGCGTTGCTGCCACCATGAGCAAGTTCATATCCGACAAGAAGCTCCCCTCTGCCTCGAGCTCAGCCGCCGACATG
AGCCTCCTCTCTGCGCTTGATGCTGCTTCAATGTTTGGGAGTTTCGGAGAACTACTAGAACCGAAGTCGTCGGCA
GTGCAGAAATTTGACAAGTACACCAAACAGCAGATGCAGCAGGGAGACTTGAGGGCATGGAAAATCCAGGCCTTC
CTCCAAGCTTATTTACCCGCAACGATGGCGTTGTCTCGCCCCACGACGTATGATAGTCTGGCGGACTTGCCGGTC
AGGCTTCAACACTCGCTCCTGAAGGAGTTGGTCACATCAATCACGGGGCATATGGACTGCCGCGAAAGGCGTCAC
TATCTTGGGGAGCTGATTGGCGAACTCGGCAAGGGCTGGGACACGGATGGCCAAATCCTAGCCATCCAGACAGTC
GTTGACCAGCTCACGGACTCCTTCGACCAGCATGAAAAGACCGATGGCTTCAGTCTAGCGGGAGCCCACAGTGAG
CTGACGCTGTCTCTGCTGCTGTTGCCGAAATCGCCCCAGGCTATGCGAATCTGTCACGCCCTACAGACGCTGCTG
GAAAGTCGACCGCAGGCTATGGGACAGTGGAACATCGAGATAACGCTGAGCGCGGTGTGTGATCTCTCGTCAATG
AGCAGTGACGAATCCGCCGTGCCTTTTGCCTCGCTCTGCAAGCTGGTCGAGACCGTCATCAAGAGGCACAGGCTT
CGCCTTGAGGGGCACTACCACGTTCTGCTGAGCGCTTTGCAGGCGCTTCTGCGGGATCTCATCATCAGACAGTCA
ACGGGGTCAGACTACGGAAATGGCCCAGAACCAAAGGCTCAGGCCTATTCCCGACTCATCAGCCTCATCTGCGAG
CCTACCACCGGCGCCGTCTCTCGGACCCAGCTTCACGGCGCGCTGGAATCCGCCACGGACGCGGCCAAGCGGTCG
GCCGGCCGACACATGTATCTGATCATGATGCAGTATGTCAAGCTGCAGCTCCAAACGAGCGTGCCCAAGGCCGTG
AGCGGGGCACTGGAGCCGGCCATGAACGCCATATTCGACATTACGCCGCCGGAGGTGAGAAAGATCCTGAACGAT
GCCGTGCAAGGAGGCGGGAGGGCAATTCTGCGGGAAATGTTCCGACGTTACGTCAAGTTTGGGAAATGGAGTGGC
GTT
Transcript >Ophio5|3685
ATGACGGATCTCATCAAGACCGTGCGAGGCATCGATCATACCGGACCTGGAAAGAATGGCGAGGGCTTGCAGCGC
CTCTGGAGCTGTCTGGCAGCATCATCTGGACGCCACTTTCATGCCGCCGAAGGGAGCACCTTGAGATGGCTTCTA
AAATCCATGAACGGGACATCTGCGGCTGCCGAGACTGTCCGCCGTTACCCCTTGACATGGACCATCCTGGCCTGC
GTATTTCAACGGGTTCCCCTCTTCTCTCTCGCCAAGTCGCTTGCCGATCGAAAGTTCATCACCGTGCTGCAAAAA
ACATTCAAGGACATCTCCAAGCCTGTCACTGGCTCTTCTTCCCCGGCCTCGTCGAAGCGCAAAAGAAACCCGCCT
GTCGGCTACGACTTGAACCAGTTGCAAGACCGTCAAGGATGCCTAGAAACCGCCACGGAGCTTTTCAAGGCTTTG
CAGTTGCTTCTGGGACGCCTTGAAAGCCCAGAAGCGGCATTCTCCCGACACCAAATGGGCGCCGAACACATCAAG
TCTCTGTTTTGCACATCGGCAGCCGAAGCAGTCAAAATCGTGGCCCCGGCATTGACGGTTTGCGACGACTTGCTG
ATCAGTGAACCGTGCGATGACTCGAGAGGCTACGAATCCTGGATAAGCATCGTCTCGCTGGTTTGGGATCTCCAT
CTCCAAGGCAACGATGATGCAGTAGAGGTCGCGAACCATCTGTTTCCGTCATCAGCGATCATTCTGGCCAGGGTC
AGTAATTTTGCTTCCAATATGGAAGCCAACATTTCCGATTTCTTAAGAAATAGATGGAGTGCCGATCTGCGTCTC
TTTATGCACCAAAACCTCATCGGTCCTGGGAGGAGAGACTTCACCAGACATAAAGTCTTGGAACCCTTTCTCCGG
GCGCTGGGCGCATCGAAAAACATCATTCAAGTCGCAGCCCCTACTTTGTACCTTCTCTGCACGGATGGCCCTGGT
CCTATTTCCGAGGGCGAACTCCGGAAAGAAGACGTGGAATGGCTCAGACGGATATTCAATGCTGTGGAGCATGCC
ATCGCGGAGCAGCCTGATCGGAGCCACATCATTCAGATTGTTCTGGACAGGGCGGCACGGCGACCTACCTCGGTG
GATGTGGACGACCTGCGCCGTGTTTGTCGTCGTTTTGCTTTGCACGAGTCGGGGACGGACTGGCCGTTGGTGGCC
AAAGTGATTGCCTGCGACTCCGACGTCCTCCTGGTGTCTGAGGAGGGGCATGCACTGAGAGCAGACATCTGTGAC
CGAATACTGAAGACGGGGTCCGGAAGTGCACACGACTGTGTCATCCCGACCGTCATCAGGGTGATTATGGAGGGT
TTTCGAACGCGTCGTGCTCTGCCCAGCTTCTTGCAGTTCTGGTTCGAACAGCTTTGCCAGGAGGAGCGGCAACGA
GACGGCCAATCTTTGCGTTGGTCGACAGTTGGCCACCTACTCAATTCAACGCAACCTCCGAGCCCCATCCTTGAG
ACAGAATTATCACCGACACAACTTCTTGGCATCATTTCCTGGGTTGAAACGCAGGCGACGGAGCTGCATCCACAA
TCCATTTGCATATTCGCGAGCACTATCGCACTCGCACTTCGAAGCGAGTCCTTTGTCGACGCTGTGGGACAAAGG
CTTCTAGACTTGGTCGCCTCCGTGGACGGCTCTAAACCTGCTTCGGCTTTGAAGTGGAGGGTCGTTTCCCAGACA
ATGAACTGGGCACCTCCGAGTGAGAGGATCCATATGTGGAACTCGGTCAAGAAACAATTGACGAAGACGTTGAAG
AAATCACCTGTCGTCTCAAGCGTCACCTTCGAGGCGTTCAAATGCTGCCTTCAGGCTTGGGACTGTATGAGCCTG
GCAGCGCAGGCAGACGAGCCTGCCCTCCTCCTGGAGAATTTTTCTGCACGATTAGTTGCGCACGATCTCGGCGCA
CTTGTCGTGGACGACAAATTGAAGCTACCGTTTACAGAAAAAAGTACGAATGGAGACTTTTCAGAAGACTGCGCC
CTTCAACATTACTTGATGTGGTGCACATATGGATCGAGCAGATTCATCAGGCTTCAATTTGCGAGGAACGGAGAC
CTTCCACCAGTTTTGTCAAACGCGTTGTCGATTCAGGACGCGCCTGTGGAACAAGTCGAAATGCTCTGGGACGCC
ATGCTACGCAACGAAATCAACCTAAATGATATACAACTCGCGACGACCTTTGTCGACCGTCTCGTGGTTGCACTA
GACGGCGCTGTCAAGGTCAAGTCGACCGGCCCAGAAGACCAAAGCCTGACTTGGATCAAACTCTTGGCCAACATA
CCGATTGAGGTTTTTAGTCGCGGGCAACGAGAGAAGCTCATGAACATCATCAACAAGCAGCGAGCGACGATGGCT
CAGTCTGATCAGGCGTCTCTCCACGCCTGGAAAATGGTCCTCAGTTTCGCAACAAAGATGATGAGACGGCCCACG
TTCTATCTTGACATGAGCTTTTCAGACCTTGTTGAGCTTGCGACAGCAATTTCTGGCATCTCCATTGACTGCTCG
TCAGGTTGTGAGACTACCCTGGAACTGATAGAGAGGTTTCTCTCAATGGCGTCGGCAACGATTAGGCAGATGGCA
GATCACCTGGATGAACGAGGCGTCAATTACTTTCGCGGGGCTTCCGAATTCGTGTCTGATTGCAAGACACGGCTT
CTCACCGTGGCAAATGCCAGCACAGCCGAATTTGGCCTTTTCATAACTCTTTTGAGGGCTCTGGTGGGCGAGTTT
TCGCGAACACCGAATCTGCGAAGCCATGAGGAACTGGCCTCGCTAGCAGTCGATTCCAAAGCGGTCCTGCAGCGT
TGCGTTGCTGCCACCATGAGCAAGTTCATATCCGACAAGAAGCTCCCCTCTGCCTCGAGCTCAGCCGCCGACATG
AGCCTCCTCTCTGCGCTTGATGCTGCTTCAATGTTTGGGAGTTTCGGAGAACTACTAGAACCGAAGTCGTCGGCA
GTGCAGAAATTTGACAAGTACACCAAACAGCAGATGCAGCAGGGAGACTTGAGGGCATGGAAAATCCAGGCCTTC
CTCCAAGCTTATTTACCCGCAACGATGGCGTTGTCTCGCCCCACGACGTATGATAGTCTGGCGGACTTGCCGGTC
AGGCTTCAACACTCGCTCCTGAAGGAGTTGGTCACATCAATCACGGGGCATATGGACTGCCGCGAAAGGCGTCAC
TATCTTGGGGAGCTGATTGGCGAACTCGGCAAGGGCTGGGACACGGATGGCCAAATCCTAGCCATCCAGACAGTC
GTTGACCAGCTCACGGACTCCTTCGACCAGCATGAAAAGACCGATGGCTTCAGTCTAGCGGGAGCCCACAGTGAG
CTGACGCTGTCTCTGCTGCTGTTGCCGAAATCGCCCCAGGCTATGCGAATCTGTCACGCCCTACAGACGCTGCTG
GAAAGTCGACCGCAGGCTATGGGACAGTGGAACATCGAGATAACGCTGAGCGCGGTGTGTGATCTCTCGTCAATG
AGCAGTGACGAATCCGCCGTGCCTTTTGCCTCGCTCTGCAAGCTGGTCGAGACCGTCATCAAGAGGCACAGGCTT
CGCCTTGAGGGGCACTACCACGTTCTGCTGAGCGCTTTGCAGGCGCTTCTGCGGGATCTCATCATCAGACAGTCA
ACGGGGTCAGACTACGGAAATGGCCCAGAACCAAAGGCTCAGGCCTATTCCCGACTCATCAGCCTCATCTGCGAG
CCTACCACCGGCGCCGTCTCTCGGACCCAGCTTCACGGCGCGCTGGAATCCGCCACGGACGCGGCCAAGCGGTCG
GCCGGCCGACACATGTATCTGATCATGATGCAGTATGTCAAGCTGCAGCTCCAAACGAGCGTGCCCAAGGCCGTG
AGCGGGGCACTGGAGCCGGCCATGAACGCCATATTCGACATTACGCCGCCGGAGGTGAGAAAGATCCTGAACGAT
GCCGTGCAAGGAGGCGGGAGGGCAATTCTGCGGGAAATGTTCCGACGTTACGTCAAGTTTGGGAAATGGAGTGGC
GTTTAG
Gene >Ophio5|3685
ATGGTGAGGACTGAACCTTCTATCTGTGTTGGAACTCGACTAAGCCGCAGAAAAAAGACGGATCTCATCAAGACC
GTGCGAGGCATCGATCATACCGGACCTGGAAAGAATGGCGAGGGCTTGCAGCGCCTCTGGAGCTGTCTGGCAGCA
TCATCTGGACGCCACTTTCATGCCGCCGAAGGGAGCACCTTGAGATGGCTTCTAAAATCCATGAACGGGACATCT
GCGGCTGCCGAGACTGTCCGCCGTTACCCCTTGACATGGACCATCCTGGCCTGCGTATTTCAACGGGTTCCCCTC
TTCTCTCTCGCCAAGTCGCTTGCCGATCGAAAGTTCATCACCGTGCTGCAAAAAACATTCAAGGACATCTCCAAG
CCTGTCACTGGCTCTTCTTCCCCGGCCTCGTCGAAGCGCAAAAGAAACCCGCCTGTCGGCTACGACTTGAACCAG
TTGCAAGACCGTCAAGGATGCCTAGAAACCGCCACGGAGCTTTTCAAGGCTTTGCAGTTGCTTCTGGGACGCCTT
GAAAGCCCAGAAGCGGCATTCTCCCGACACCAAATGGGCGCCGAACACATCAAGTCTCTGTTTTGCACATCGGCA
GCCGAAGCAGTCAAAATCGTGGCCCCGGCATTGACGGTTTGCGACGACTTGCTGATCAGTGAACCGTGCGATGAC
TCGAGAGGCTACGAATCCTGGATAAGCATCGTCTCGCTGGTTTGGGATCTCCATCTCCAAGGCAACGATGATGCA
GTAGAGGTCGCGAACCATCTGTTTCCGTCATCAGCGATCATTCTGGCCAGGGTCAGTAATTTTGCTTCCAATATG
GAAGCCAACATTTCCGATTTCTTAAGAAATAGATGGAGTGCCGATCTGCGTCTCTTTATGCACCAAAACCTCATC
GGTCCTGGGAGGAGAGACTTCACCAGACATAAAGTCTTGGAACCCTTTCTCCGGGCGCTGGGCGCATCGAAAAAC
ATCATTCAAGTCGCAGCCCCTACTTTGTACCTTCTCTGCACGGATGGCCCTGGTCCTATTTCCGAGGGCGAACTC
CGGAAAGAAGACGTGGAATGGCTCAGACGGATATTCAATGCTGTGGAGCATGCCATCGCGGAGCAGCCTGATCGG
AGCCACATCATTCAGATTGTTCTGGACAGGGCGGCACGGCGACCTACCTCGGTGGATGTGGACGACCTGCGCCGT
GTTTGTCGTCGTTTTGCTTTGCACGAGTCGGGGACGGACTGGCCGTTGGTGGCCAAAGTGATTGCCTGCGACTCC
GACGTCCTCCTGGTGTCTGAGGAGGGGCATGCACTGAGAGCAGACATCTGTGACCGAATACTGAAGACGGGGTCC
GGAAGTGCACACGACTGTGTCATCCCGACCGTCATCAGGGTGATTATGGAGGGTTTTCGAACGCGTCGTGCTCTG
CCCAGCTTCTTGCAGTTCTGGTTCGAACAGCTTTGCCAGGAGGAGCGGCAACGAGACGGCCAATCTTTGCGTTGG
TCGACAGTTGGCCACCTACTCAATTCAACGCAACCTCCGAGCCCCATCCTTGAGACAGAATTATCACCGACACAA
CTTCTTGGCATCATTTCCTGGGTTGAAACGCAGGCGACGGAGCTGCATCCACAATCCATTTGCATATTCGCGAGC
ACTATCGCACTCGCACTTCGAAGCGAGTCCTTTGTCGACGCTGTGGGACAAAGGCTTCTAGACTTGGTCGCCTCC
GTGGACGGCTCTAAACCTGCTTCGGCTTTGAAGTGGAGGGTCGTTTCCCAGACAATGAACTGGGCACCTCCGAGT
GAGAGGATCCATATGTGGAACTCGGTCAAGAAACAATTGACGAAGACGTTGAAGAAATCACCTGTCGTCTCAAGC
GTCACCTTCGAGGCGTTCAAATGCTGCCTTCAGGCTTGGGACTGTATGAGCCTGGCAGCGCAGGCAGACGAGCCT
GCCCTCCTCCTGGAGAATTTTTCTGCACGATTAGTTGCGCACGATCTCGGCGCACTTGTCGTGGACGACAAATTG
AAGCTACCGTTTACAGAAAAAAGTACGAATGGAGACTTTTCAGAAGACTGCGCCCTTCAACATTACTTGATGTGG
TGCACATATGGATCGAGCAGATTCATCAGGCTTCAATTTGCGAGGAACGGAGACCTTCCACCAGTTTTGTCAAAC
GCGTTGTCGATTCAGGACGCGCCTGTGGAACAAGTCGAAATGCTCTGGGACGCCATGCTACGCAACGAAATCAAC
CTAAATGATATACAACTCGCGACGACCTTTGTCGACCGTCTCGTGGTTGCACTAGACGGCGCTGTCAAGGTCAAG
TCGACCGGCCCAGAAGACCAAAGCCTGACTTGGATCAAACTCTTGGCCAACATACCGATTGAGGTTTTTAGTCGC
GGGCAACGAGAGAAGCTCATGAACATCATCAACAAGCAGCGAGCGACGATGGCTCAGTCTGATCAGGCGTCTCTC
CACGCCTGGAAAATGGTCCTCAGTTTCGCAACAAAGATGATGAGACGGCCCACGTTCTATCTTGACATGAGCTTT
TCAGACCTTGTTGAGCTTGCGACAGCAATTTCTGGCATCTCCATTGACTGCTCGTCAGGTTGTGAGACTACCCTG
GAACTGATAGAGAGGTTTCTCTCAATGGCGTCGGCAACGATTAGGCAGATGGCAGATCACCTGGATGAACGAGGC
GTCAATTACTTTCGCGGGGCTTCCGAATTCGTGTCTGATTGCAAGACACGGCTTCTCACCGTGGCAAATGCCAGC
ACAGCCGAATTTGGCCTTTTCATAACTCTTTTGAGGGCTCTGGTGGGCGAGTTTTCGCGAACACCGAATCTGCGA
AGCCATGAGGAACTGGCCTCGCTAGCAGTCGATTCCAAAGCGGTCCTGCAGCGTTGCGTTGCTGCCACCATGAGC
AAGTTCATATCCGACAAGAAGCTCCCCTCTGCCTCGAGCTCAGCCGCCGACATGAGCCTCCTCTCTGCGCTTGAT
GCTGCTTCAATGTTTGGGAGTTTCGGAGAACTACTAGAACCGAAGTCGTCGGCAGTGCAGAAATTTGACAAGTAC
ACCAAACAGCAGATGCAGCAGGGAGACTTGAGGGCATGGAAAATCCAGGCCTTCCTCCAAGCTTATTTACCCGCA
ACGATGGCGTTGTCTCGCCCCACGACGTATGATAGTCTGGCGGACTTGCCGGTCAGGCTTCAACACTCGCTCCTG
AAGGAGTTGGTCACATCAATCACGGGGCATATGGACTGCCGCGAAAGGCGTCACTATCTTGGGGAGCTGATTGGC
GAACTCGGCAAGGGCTGGGACACGGATGGCCAAATCCTAGCCATCCAGACAGTCGTTGACCAGCTCACGGGTATG
TCCTACCTCGACTCTGGCGAGGCTTTAGTACTAACGGTGTGCAGACTCCTTCGACCAGCATGAAAAGACCGATGG
CTTCAGTCTAGCGGGAGCCCACAGTGAGCTGACGCTGTCTCTGCTGCTGTTGCCGAAATCGCCCCAGGCTATGCG
AATCTGTCACGCCCTACAGACGCTGCTGGAAAGTCGACCGCAGGCTATGGGACAGTGGAACATCGAGATAACGCT
GAGCGCGGTGTGTGATCTCTCGTCAATGAGCAGTGACGAATCCGCCGTGCCTTTTGCCTCGCTCTGCAAGCTGGT
CGAGACCGTCATCAAGAGGCACAGGCTTCGCCTTGAGGGGCACTACCACGTTCTGCTGAGCGCTTTGCAGGCGCT
TCTGCGGGATCTCATCATCAGACAGTCAACGGGGTCAGACTACGGAAATGGCCCAGAACCAAAGGCTCAGGCCTA
TTCCCGACTCATCAGCCTCATCTGCGAGCCTACCACCGGCGCCGTCTCTCGGACCCAGCTTCACGGCGCGCTGGA
ATCCGCCACGGACGCGGCCAAGCGGTCGGCCGGCCGACACATGTATCTGATCATGATGCAGTATGTCAAGCTGCA
GCTCCAAACGAGCGTGCCCAAGGCCGTGAGCGGGGCACTGGAGCCGGCCATGAACGCCATATTCGACATTACGCC
GCCGGAGGTGAGAAAGATCCTGAACGATGCCGTGCAAGGAGGCGGGAGGGCAATTCTGCGGGAAATGTTCCGACG
TTACGTCAAGTTTGGGAAATGGAGTGGCGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail