Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3684
Gene name
Locationscaffold_290:10752..11283
Strand-
Gene length (bp)531
Transcript length (bp)351
Coding sequence length (bp)348
Protein length (aa) 116

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04418 DUF543 Domain of unknown function (DUF543) 1.8E-30 37 102

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYI0|MIC10_NEUCR MICOS complex subunit mic10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic10 PE=3 SV=1 27 114 3.0E-47
sp|Q9HFF0|MIC10_SCHPO MICOS complex subunit mic10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mic10 PE=3 SV=1 44 105 1.0E-17
sp|Q751T2|MIC10_ASHGO MICOS complex subunit MIC10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MIC10 PE=3 SV=1 39 101 4.0E-17
sp|Q96VH5|MIC10_YEAST MICOS complex subunit MIC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIC10 PE=1 SV=1 27 108 7.0E-17
sp|Q5TGZ0|MIC10_HUMAN MICOS complex subunit MIC10 OS=Homo sapiens GN=MINOS1 PE=1 SV=1 43 105 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYI0|MIC10_NEUCR MICOS complex subunit mic10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic10 PE=3 SV=1 27 114 3.0E-47
sp|Q9HFF0|MIC10_SCHPO MICOS complex subunit mic10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mic10 PE=3 SV=1 44 105 1.0E-17
sp|Q751T2|MIC10_ASHGO MICOS complex subunit MIC10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MIC10 PE=3 SV=1 39 101 4.0E-17
sp|Q96VH5|MIC10_YEAST MICOS complex subunit MIC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIC10 PE=1 SV=1 27 108 7.0E-17
sp|Q5TGZ0|MIC10_HUMAN MICOS complex subunit MIC10 OS=Homo sapiens GN=MINOS1 PE=1 SV=1 43 105 1.0E-14
sp|Q7TNS2|MIC10_MOUSE MICOS complex subunit Mic10 OS=Mus musculus GN=Minos1 PE=1 SV=1 43 105 3.0E-14
sp|B2RYW8|MIC10_RAT MICOS complex subunit Mic10 OS=Rattus norvegicus GN=Minos1 PE=3 SV=1 43 105 4.0E-13
sp|Q9N4K0|MIC10_CAEEL MICOS complex subunit Mic10 OS=Caenorhabditis elegans GN=F54A3.5 PE=3 SV=2 44 100 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005743 mitochondrial inner membrane Yes
GO:0061617 MICOS complex Yes
GO:0098800 inner mitochondrial membrane protein complex No
GO:0098796 membrane protein complex No
GO:0110165 cellular anatomical entity No
GO:0016020 membrane No
GO:0019866 organelle inner membrane No
GO:0031966 mitochondrial membrane No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0098798 mitochondrial protein-containing complex No
GO:0031090 organelle membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 56 78 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3684
MVHRPTLASGAPLHSPTFCHNVAAPIMSETALPPPPSAVSRPVSEALLNEKWDRCLSNLLVKSTLGLGFGVVFSV
LLFKRRAWPAFVGVGFGAGRAYEECNFSLKQAARDLRMQKA
Coding >Ophio5|3684
ATGGTTCACCGCCCTACCCTTGCTTCTGGCGCCCCTCTCCACAGCCCAACCTTCTGCCACAACGTGGCAGCGCCC
ATCATGTCCGAGACCGCCCTCCCTCCGCCCCCGAGCGCCGTGTCGCGGCCCGTGAGCGAGGCGCTACTCAACGAA
AAGTGGGATCGTTGTCTCTCCAATCTCCTCGTCAAGTCGACCCTCGGCCTCGGATTCGGAGTCGTCTTCTCCGTC
CTGTTGTTCAAGCGAAGAGCGTGGCCCGCCTTCGTCGGTGTCGGATTCGGCGCGGGGCGAGCATACGAGGAGTGC
AACTTTAGCCTGAAGCAAGCCGCGCGGGATCTGAGGATGCAGAAGGCG
Transcript >Ophio5|3684
ATGGTTCACCGCCCTACCCTTGCTTCTGGCGCCCCTCTCCACAGCCCAACCTTCTGCCACAACGTGGCAGCGCCC
ATCATGTCCGAGACCGCCCTCCCTCCGCCCCCGAGCGCCGTGTCGCGGCCCGTGAGCGAGGCGCTACTCAACGAA
AAGTGGGATCGTTGTCTCTCCAATCTCCTCGTCAAGTCGACCCTCGGCCTCGGATTCGGAGTCGTCTTCTCCGTC
CTGTTGTTCAAGCGAAGAGCGTGGCCCGCCTTCGTCGGTGTCGGATTCGGCGCGGGGCGAGCATACGAGGAGTGC
AACTTTAGCCTGAAGCAAGCCGCGCGGGATCTGAGGATGCAGAAGGCGTGA
Gene >Ophio5|3684
ATGGTTCACCGCCCTACCCTTGCTTCTGGCGCCCGTGAAGCTTAGCATCGCCAATTCCTGGGATGGAGAAGCTGT
CCGTTCAGAGCTCCGACTCCAGCTCTCCACAGCCCAACCTTCTGCCACAGTGAGTCGACTTCGTTGCCGTTTCCC
CAAATTGATACATCCCAGACTAGCAAATGACACTCTAGACGTGGCAGCGCCCATCATGTCCGAGACCGCCCTCCC
TCCGCCCCCGAGCGCCGTGTCGCGGCCCGTGAGCGAGGCGCTACTCAACGAAAAGGTACGTGTTTGATCATCCGA
GAATGCAGCTACTGATTGGTTCCTCGTTACCAGTGGGATCGTTGTCTCTCCAATCTCCTCGTCAAGTCGACCCTC
GGCCTCGGATTCGGAGTCGTCTTCTCCGTCCTGTTGTTCAAGCGAAGAGCGTGGCCCGCCTTCGTCGGTGTCGGA
TTCGGCGCGGGGCGAGCATACGAGGAGTGCAACTTTAGCCTGAAGCAAGCCGCGCGGGATCTGAGGATGCAGAAG
GCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail