Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3679
Gene name
Locationscaffold_29:74271..76516
Strand-
Gene length (bp)2245
Transcript length (bp)2055
Coding sequence length (bp)2052
Protein length (aa) 684

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1247 0.0876 0.9229 0.1001 0.145 0.0891 0.23 0.1843 0.2612 0.0076

SignalP

SignalP signal predicted Location Score
Yes 1 - 26 0.999464

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup515
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7433
Ophiocordyceps australis map64 (Brazil) OphauB2|1555
Ophiocordyceps australis map64 (Brazil) OphauB2|595
Ophiocordyceps camponoti-floridani Ophcf2|06721
Ophiocordyceps camponoti-floridani Ophcf2|07183
Ophiocordyceps camponoti-rufipedis Ophun1|2349
Ophiocordyceps camponoti-rufipedis Ophun1|462
Ophiocordyceps kimflemingae Ophio5|3679 (this protein)
Ophiocordyceps subramaniannii Hirsu2|226

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3679
MKSWSWTSWALAASSLTLRWPSQSQAAPQEKDIPTILTPASYVTPADEPQVLYFLCGANPRPDRLRSAGGLVPRL
PNPTPDEVWGYATVTSQGSAWAQLWRDWRHPLAITTNWNSQSALHLYEVSTCPNMVAHFHRSHLNQAYWALGGFL
WSQVRRYAAINPGDDVDNPNWIENIDFDPRWNRFHTSGWQPELSGYSTSHPVWFDRDWRSRRPAPAMTRREQALL
FIRGIMQNSLLRGLFEWNGHLPLIRVRDPAWATPLARFERQAPLQNFQLDTLKVPEDVVQEYREKGSLSEEGCRV
ISLAISLSVWMHAALPRRGSHRRRSAELAAGDSPYEYCLLTNNTSQCDAVSQTDGTDCDALTNAIGQLNVASTYS
EPYGSSGLPKTACSHLGRLIFMVNIADELYAGTYDEITARVGPSWSFEVAKEPHTLSRGESRQVELGMMKVFPSQ
TVALNEIDRISISARRVNAFGGDWWKIKGVQLQGQCSDSLTTIHLESFASINLGVKNEGRWRQRTEVWAGPVGPE
DWDVTSYCTHFESLEFDVELGNGIGGGTYDDILIQIGRQQLSVMEQPWAGEEKKMQVNLNEAFGAKLVPVDKLIK
FSIFSFPDGRGLGDWWELGGVSFEARCQRSGKRYRVDKYSKLDVWRLRDVGYKDHFDGKITLRDWKESSKTVANY
EVVRISDYM
Coding >Ophio5|3679
ATGAAGTCTTGGAGCTGGACCAGTTGGGCCCTCGCGGCATCCTCGTTAACGCTACGATGGCCTAGCCAAAGCCAG
GCGGCGCCTCAAGAGAAGGACATACCAACCATACTAACCCCAGCGTCGTACGTTACCCCGGCTGACGAGCCCCAA
GTCCTTTATTTCCTATGCGGGGCCAATCCTAGACCCGACCGACTGCGTTCCGCGGGCGGACTCGTGCCTCGACTC
CCCAACCCAACTCCCGACGAAGTATGGGGCTATGCCACCGTCACAAGCCAGGGCAGCGCCTGGGCCCAGCTTTGG
AGGGACTGGAGGCATCCCTTGGCCATTACGACCAACTGGAACTCCCAATCTGCCCTACACTTGTACGAGGTCTCG
ACATGTCCAAACATGGTCGCTCACTTTCACCGGTCCCACTTGAATCAGGCATATTGGGCCTTGGGCGGGTTCCTT
TGGTCCCAAGTAAGAAGATACGCTGCCATCAACCCAGGCGATGACGTCGACAATCCCAATTGGATCGAAAACATC
GACTTCGACCCAAGATGGAACAGATTCCACACCAGTGGCTGGCAGCCCGAGCTGTCTGGCTATTCCACAAGCCAT
CCCGTATGGTTTGATCGTGACTGGAGAAGCCGTAGACCTGCCCCCGCCATGACGCGTCGCGAACAGGCCCTCCTC
TTCATCAGGGGTATCATGCAAAACTCACTGCTCAGGGGGCTGTTTGAGTGGAACGGCCATCTGCCCTTGATCCGT
GTTCGCGACCCAGCCTGGGCTACTCCTTTGGCTCGCTTCGAGCGCCAGGCGCCGCTGCAAAACTTCCAACTGGAT
ACGCTAAAGGTGCCCGAGGACGTGGTGCAAGAGTACAGAGAAAAGGGCAGCTTGTCGGAGGAAGGATGTCGAGTC
ATCTCTCTTGCCATCTCCCTTTCCGTCTGGATGCACGCGGCTCTGCCTCGTCGAGGATCGCACCGGAGAAGATCG
GCAGAATTGGCGGCAGGGGACAGCCCTTACGAATACTGCCTGTTAACAAACAACACGAGCCAATGCGATGCAGTC
TCACAAACTGATGGAACCGACTGCGATGCCCTCACCAACGCGATAGGCCAACTCAACGTGGCAAGTACTTATAGC
GAGCCCTACGGCTCGTCAGGACTGCCGAAGACAGCTTGCAGCCATCTGGGACGGCTGATTTTCATGGTCAACATA
GCTGATGAATTATATGCCGGAACGTACGACGAAATAACGGCCAGAGTTGGTCCATCGTGGAGCTTCGAGGTCGCC
AAGGAGCCTCACACCCTGTCAAGGGGAGAATCTAGACAAGTAGAGTTGGGCATGATGAAAGTGTTTCCCTCCCAG
ACTGTTGCGCTAAACGAAATTGACCGCATCTCCATCTCAGCCAGGCGTGTCAACGCCTTTGGGGGAGACTGGTGG
AAGATTAAAGGCGTACAGTTACAAGGCCAATGCAGCGACTCGCTCACGACTATCCATCTCGAAAGCTTCGCATCC
ATCAACCTGGGCGTCAAGAACGAAGGCAGGTGGCGGCAGCGGACCGAGGTCTGGGCTGGCCCAGTCGGACCCGAA
GACTGGGACGTGACAAGCTACTGTACCCATTTCGAAAGCCTCGAGTTTGACGTTGAGCTGGGCAACGGAATAGGC
GGGGGCACCTACGATGACATTCTGATCCAAATCGGCCGCCAGCAGCTGTCCGTCATGGAGCAACCTTGGGCAGGC
GAGGAGAAAAAGATGCAAGTCAACCTAAACGAAGCCTTTGGAGCGAAGCTTGTTCCAGTGGACAAGTTGATCAAG
TTTTCCATCTTCTCCTTCCCTGATGGCCGCGGGCTGGGAGACTGGTGGGAACTAGGAGGCGTGAGTTTCGAAGCG
CGATGCCAACGGTCCGGTAAAAGGTACAGAGTCGACAAATACTCAAAACTCGACGTGTGGCGACTGCGCGATGTG
GGATACAAGGATCATTTCGATGGCAAGATAACTTTGAGAGACTGGAAGGAGTCGTCGAAAACGGTGGCCAACTAT
GAGGTAGTACGGATAAGCGATTACATG
Transcript >Ophio5|3679
ATGAAGTCTTGGAGCTGGACCAGTTGGGCCCTCGCGGCATCCTCGTTAACGCTACGATGGCCTAGCCAAAGCCAG
GCGGCGCCTCAAGAGAAGGACATACCAACCATACTAACCCCAGCGTCGTACGTTACCCCGGCTGACGAGCCCCAA
GTCCTTTATTTCCTATGCGGGGCCAATCCTAGACCCGACCGACTGCGTTCCGCGGGCGGACTCGTGCCTCGACTC
CCCAACCCAACTCCCGACGAAGTATGGGGCTATGCCACCGTCACAAGCCAGGGCAGCGCCTGGGCCCAGCTTTGG
AGGGACTGGAGGCATCCCTTGGCCATTACGACCAACTGGAACTCCCAATCTGCCCTACACTTGTACGAGGTCTCG
ACATGTCCAAACATGGTCGCTCACTTTCACCGGTCCCACTTGAATCAGGCATATTGGGCCTTGGGCGGGTTCCTT
TGGTCCCAAGTAAGAAGATACGCTGCCATCAACCCAGGCGATGACGTCGACAATCCCAATTGGATCGAAAACATC
GACTTCGACCCAAGATGGAACAGATTCCACACCAGTGGCTGGCAGCCCGAGCTGTCTGGCTATTCCACAAGCCAT
CCCGTATGGTTTGATCGTGACTGGAGAAGCCGTAGACCTGCCCCCGCCATGACGCGTCGCGAACAGGCCCTCCTC
TTCATCAGGGGTATCATGCAAAACTCACTGCTCAGGGGGCTGTTTGAGTGGAACGGCCATCTGCCCTTGATCCGT
GTTCGCGACCCAGCCTGGGCTACTCCTTTGGCTCGCTTCGAGCGCCAGGCGCCGCTGCAAAACTTCCAACTGGAT
ACGCTAAAGGTGCCCGAGGACGTGGTGCAAGAGTACAGAGAAAAGGGCAGCTTGTCGGAGGAAGGATGTCGAGTC
ATCTCTCTTGCCATCTCCCTTTCCGTCTGGATGCACGCGGCTCTGCCTCGTCGAGGATCGCACCGGAGAAGATCG
GCAGAATTGGCGGCAGGGGACAGCCCTTACGAATACTGCCTGTTAACAAACAACACGAGCCAATGCGATGCAGTC
TCACAAACTGATGGAACCGACTGCGATGCCCTCACCAACGCGATAGGCCAACTCAACGTGGCAAGTACTTATAGC
GAGCCCTACGGCTCGTCAGGACTGCCGAAGACAGCTTGCAGCCATCTGGGACGGCTGATTTTCATGGTCAACATA
GCTGATGAATTATATGCCGGAACGTACGACGAAATAACGGCCAGAGTTGGTCCATCGTGGAGCTTCGAGGTCGCC
AAGGAGCCTCACACCCTGTCAAGGGGAGAATCTAGACAAGTAGAGTTGGGCATGATGAAAGTGTTTCCCTCCCAG
ACTGTTGCGCTAAACGAAATTGACCGCATCTCCATCTCAGCCAGGCGTGTCAACGCCTTTGGGGGAGACTGGTGG
AAGATTAAAGGCGTACAGTTACAAGGCCAATGCAGCGACTCGCTCACGACTATCCATCTCGAAAGCTTCGCATCC
ATCAACCTGGGCGTCAAGAACGAAGGCAGGTGGCGGCAGCGGACCGAGGTCTGGGCTGGCCCAGTCGGACCCGAA
GACTGGGACGTGACAAGCTACTGTACCCATTTCGAAAGCCTCGAGTTTGACGTTGAGCTGGGCAACGGAATAGGC
GGGGGCACCTACGATGACATTCTGATCCAAATCGGCCGCCAGCAGCTGTCCGTCATGGAGCAACCTTGGGCAGGC
GAGGAGAAAAAGATGCAAGTCAACCTAAACGAAGCCTTTGGAGCGAAGCTTGTTCCAGTGGACAAGTTGATCAAG
TTTTCCATCTTCTCCTTCCCTGATGGCCGCGGGCTGGGAGACTGGTGGGAACTAGGAGGCGTGAGTTTCGAAGCG
CGATGCCAACGGTCCGGTAAAAGGTACAGAGTCGACAAATACTCAAAACTCGACGTGTGGCGACTGCGCGATGTG
GGATACAAGGATCATTTCGATGGCAAGATAACTTTGAGAGACTGGAAGGAGTCGTCGAAAACGGTGGCCAACTAT
GAGGTAGTACGGATAAGCGATTACATGTAG
Gene >Ophio5|3679
ATGAAGTCTTGGAGCTGGACCAGTTGGGCCCTCGCGGCATCCTCGTTAACGCTACGATGGCCTAGCCAAAGCCAG
GCGGCGCCTCAAGAGAAGGACATACCAACCATACTAACCCCAGCGTCGTACGTTACCCCGGCTGACGAGCCCCAA
GTCCTTTATTTCCTATGCGGGGCCAATCCTAGACCCGACCGACTGCGTTCCGCGGGCGGACTCGTGCCTCGACTC
CCCAACCCAACTCCCGACGAAGTATGGGGCTATGCCACCGTCACAAGCCAGGGCAGCGCCTGGGCCCAGCTTTGG
AGGGACTGGAGGCATCCCTTGGCCATTACGACCAACTGGAACTCCCAATCTGCCCTACACTTGTACGAGGTCTCG
ACATGTCCAAACATGGTCGCTCACTTTCACCGGTCCCACTTGAATCAGGCATATTGGGCCTTGGGCGGGTTCCTT
TGGTCCCAAGTAAGAAGATACGCTGCCATCAACCCAGGCGATGACGTCGACAATCCCAATTGGATCGAAAACATC
GACTTCGACCCAAGATGGAACAGATTCCACACCAGTGGCTGGCAGCCCGAGCTGTCTGGCTATTCCACAAGCCAT
CCCGTATGGTTTGATCGTGACTGGAGAAGCCGTAGACCTGCCCCCGCCATGACGCGTCGCGAACAGGCCCTCCTC
TTCATCAGGGGTATCATGCAAAACTCACTGCTCAGGGGGCTGTTTGAGTGGAACGGCCATCTGCCCTTGATCCGT
GTTCGCGACCCAGCCTGGGCTACTCCTTTGGCTCGCTTCGAGCGCCAGGCGCCGCTGCAAAACTTCCAACTGGAT
ACGCTAAAGGTGCCCGAGGACGTGGTGCAAGAGTACAGAGAAAAGGGCAGCTTGTCGGAGGAAGGATGTCGAGTC
ATCTCTCTTGCCATCTCCCTTTCCGTCTGGATGCACGCGGCTCTGCCTCGTCGAGGATCGCACCGGAGAAGATCG
GCAGGTGTGTGTGCAGCATTGCCGTCAAGGATTGCAACGAGAGCGGTACTGAAAGCATGGATCGTCAGAATTGGC
GGCAGGGGACAGCCCTTACGAATACTGCCTGTTAACAAACAACACGAGCCAATGCGATGCAGTCTCACAAACTGA
TGGAACCGACTGCGATGCCCTCACCAACGCGATAGGCCAACTCAACGTGGCAAGTACTTATAGCGAGCCCTACGG
CTCGTCAGGACTGCCGAAGACAGCTTGCAGCCATCTGGGACGGCTGATTTTCATGGTCAACATAGCTGATGAATT
ATATGCCGGAACGTACGACGAAATAACGGCCAGAGTTGGTCCATCGTGGAGCTTCGAGGTCGCCAAGGAGCCTCA
CACCCTGTCAAGGGGAGAATCTAGACAAGTAGAGTTGGGCATGATGAAAGTGTTTCCCTCCCAGACTGTTGCGCT
AAACGAAATTGACCGCATCTCCATCTCAGCCAGGCGTGTCAACGCCTTTGGGGGAGACTGGTGGAAGATTAAAGG
TATGCCTTTTTTTTTTTTTCCCAGGTCCGTCTTGATGACCGCGGACAAGGAAAGCTCAGCATACTTTTTCAAGGC
GTACAGTTACAAGGCCAATGCAGCGACTCGCTCACGACTATCCATCTCGAAAGCTTCGCATCCATCAACCTGGGC
GTCAAGAACGAAGGCAGGTGGCGGCAGCGGACCGAGGTCTGGGCTGGCCCAGTCGGACCCGAAGACTGGGACGTG
ACAAGCTACTGTACCCATTTCGAAAGCCTCGAGTTTGACGTTGAGCTGGGCAACGGAATAGGCGGGGGCACCTAC
GATGACATTCTGATCCAAATCGGCCGCCAGCAGCTGTCCGTCATGGAGCAACCTTGGGCAGGCGAGGAGAAAAAG
ATGCAAGTCAACCTAAACGAAGCCTTTGGAGCGAAGCTTGTTCCAGTGGACAAGTTGATCAAGTTTTCCATCTTC
TCCTTCCCTGATGGCCGCGGGCTGGGAGACTGGTGGGAACTAGGAGGCGAGTCACCCAGTCCACCATCTGATTTC
AAACCTTCTAAGGAAGACGCCAGGCGTGAGTTTCGAAGCGCGATGCCAACGGTCCGGTAAAAGGTACAGAGTCGA
CAAATACTCAAAACTCGACGTGTGGCGACTGCGCGATGTGGGATACAAGGATCATTTCGATGGCAAGATAACTTT
GAGAGACTGGAAGGAGTCGTCGAAAACGGTGGCCAACTATGAGGTAGTACGGATAAGCGATTACATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail