Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3676
Gene name
Locationscaffold_29:68616..69706
Strand+
Gene length (bp)1090
Transcript length (bp)981
Coding sequence length (bp)978
Protein length (aa) 326

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03881 Fructosamin_kin Fructosamine kinase 7.2E-68 22 322

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K274|KT3K_MOUSE Ketosamine-3-kinase OS=Mus musculus GN=Fn3krp PE=1 SV=2 41 321 9.0E-36
sp|Q9HA64|KT3K_HUMAN Ketosamine-3-kinase OS=Homo sapiens GN=FN3KRP PE=1 SV=2 41 321 2.0E-34
sp|Q9ER35|FN3K_MOUSE Fructosamine-3-kinase OS=Mus musculus GN=Fn3k PE=1 SV=1 41 320 9.0E-33
sp|Q9H479|FN3K_HUMAN Fructosamine-3-kinase OS=Homo sapiens GN=FN3K PE=1 SV=1 41 320 2.0E-32
sp|A2XBT1|FN3KR_ORYSI Protein-ribulosamine 3-kinase, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_09747 PE=3 SV=1 41 322 4.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K274|KT3K_MOUSE Ketosamine-3-kinase OS=Mus musculus GN=Fn3krp PE=1 SV=2 41 321 9.0E-36
sp|Q9HA64|KT3K_HUMAN Ketosamine-3-kinase OS=Homo sapiens GN=FN3KRP PE=1 SV=2 41 321 2.0E-34
sp|Q9ER35|FN3K_MOUSE Fructosamine-3-kinase OS=Mus musculus GN=Fn3k PE=1 SV=1 41 320 9.0E-33
sp|Q9H479|FN3K_HUMAN Fructosamine-3-kinase OS=Homo sapiens GN=FN3K PE=1 SV=1 41 320 2.0E-32
sp|A2XBT1|FN3KR_ORYSI Protein-ribulosamine 3-kinase, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_09747 PE=3 SV=1 41 322 4.0E-32
sp|Q10SM2|FN3KR_ORYSJ Protein-ribulosamine 3-kinase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0117800 PE=2 SV=1 48 322 8.0E-32
sp|Q9LEW8|FN3KR_ARATH Protein-ribulosamine 3-kinase, chloroplastic OS=Arabidopsis thaliana GN=At3g61080 PE=1 SV=2 1 322 9.0E-31
sp|P74594|Y1563_SYNY3 Uncharacterized protein slr1563 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1563 PE=3 SV=1 44 305 2.0E-26
sp|Q87PM1|Y1481_VIBPA Uncharacterized protein VP1481 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VP1481 PE=3 SV=1 4 322 1.0E-24
sp|Q9KRU5|Y1539_VIBCH Uncharacterized protein VC_1539 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_1539 PE=3 SV=1 8 322 7.0E-22
sp|Q8D9N5|Y2562_VIBVU Uncharacterized protein VV1_2562 OS=Vibrio vulnificus (strain CMCP6) GN=VV1_2562 PE=3 SV=1 98 322 1.0E-15
sp|P58065|YNIA_ECO57 Uncharacterized protein YniA OS=Escherichia coli O157:H7 GN=yniA PE=3 SV=1 48 322 1.0E-12
sp|P77739|YNIA_ECOLI Uncharacterized protein YniA OS=Escherichia coli (strain K12) GN=yniA PE=3 SV=1 48 322 1.0E-12
sp|Q9CN56|Y587_PASMU Uncharacterized protein PM0587 OS=Pasteurella multocida (strain Pm70) GN=PM0587 PE=3 SV=1 51 300 1.0E-11
sp|P46381|YNIA_ENTAK Uncharacterized protein EAE_16955 OS=Enterobacter aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006) GN=EAE_16955 PE=3 SV=2 47 317 1.0E-11
sp|P46382|YNIA_KLEPN Uncharacterized protein in tonB 3'region (Fragment) OS=Klebsiella pneumoniae PE=3 SV=1 210 307 8.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7442 0.7701 0.3608 0.0277 0.3104 0.2217 0.1732 0.1011 0.0407 0.0112

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup635
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1624
Ophiocordyceps australis map64 (Brazil) OphauB2|6753
Ophiocordyceps camponoti-floridani Ophcf2|06717
Ophiocordyceps camponoti-rufipedis Ophun1|459
Ophiocordyceps kimflemingae Ophio5|3676 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1032
Ophiocordyceps subramaniannii Hirsu2|6235

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3676
MTSSSVDPAILEALGLDGAQTKMAPHGGSSFSSTFKLTTTTDSGERRSLFVKTGAGREAELMFCGEHASLNAIND
AVADFCPRSHAHGPLASAPNRFFLVTDFVEFSSAASPGSRLSLAAKLAKLHTTPAPVPAGYETPVFGFPVSTFCG
ETAQDNSWKTSWADFYANNRLRGILRACVAKNGPDADLADAVEKVAVTVVPRLLGDGHLHHPIVPVVVHGDLWNG
NHGTGRIGGRAGAENVVFDPSAAYAHSEYELGIMRMFGSFSPDFWTEYHKLVHKAEPEAEWEDRIMLYELYHHLN
HFAIFGGVYRGGAMSILRKLTAKYGG
Coding >Ophio5|3676
ATGACCTCCAGCTCTGTGGACCCGGCTATCCTCGAGGCTCTGGGGCTCGACGGCGCCCAGACCAAGATGGCCCCG
CACGGCGGCTCCAGCTTCTCGTCGACCTTTAAGCTGACGACGACGACCGACAGTGGAGAGCGGCGGAGTTTGTTC
GTCAAGACGGGCGCCGGCCGCGAGGCAGAACTTATGTTTTGCGGTGAGCATGCGTCTCTCAACGCCATCAACGAC
GCCGTCGCCGACTTCTGCCCCAGATCGCACGCCCACGGCCCCCTAGCGTCGGCCCCGAACCGCTTCTTCCTCGTC
ACCGACTTCGTCGAATTCTCCTCGGCCGCCTCGCCCGGCTCGCGCCTCTCGCTCGCTGCTAAGCTGGCCAAACTG
CACACGACGCCCGCTCCCGTTCCAGCCGGCTATGAAACACCCGTCTTTGGCTTTCCCGTCTCGACTTTCTGCGGC
GAGACGGCCCAGGACAATAGCTGGAAGACGTCGTGGGCCGACTTCTATGCCAACAACCGCCTGCGCGGCATCCTG
CGCGCCTGCGTCGCCAAAAACGGGCCCGACGCCGACCTGGCCGACGCAGTGGAAAAGGTGGCCGTCACTGTCGTC
CCACGCCTCCTCGGTGACGGCCACCTCCACCATCCCATCGTTCCAGTCGTCGTCCACGGCGACCTATGGAACGGC
AATCACGGCACGGGCCGGATAGGAGGCAGGGCTGGCGCTGAGAATGTCGTCTTCGACCCCTCAGCCGCGTACGCC
CACTCAGAATATGAGCTGGGCATCATGCGCATGTTTGGCAGTTTCAGCCCTGACTTCTGGACCGAATACCACAAA
CTCGTCCACAAGGCGGAGCCGGAGGCTGAGTGGGAAGATCGTATCATGCTGTACGAGCTGTATCACCATCTGAAC
CACTTTGCCATCTTCGGTGGCGTCTATCGAGGCGGGGCCATGTCCATCTTGAGAAAGCTCACAGCCAAATATGGC
GGC
Transcript >Ophio5|3676
ATGACCTCCAGCTCTGTGGACCCGGCTATCCTCGAGGCTCTGGGGCTCGACGGCGCCCAGACCAAGATGGCCCCG
CACGGCGGCTCCAGCTTCTCGTCGACCTTTAAGCTGACGACGACGACCGACAGTGGAGAGCGGCGGAGTTTGTTC
GTCAAGACGGGCGCCGGCCGCGAGGCAGAACTTATGTTTTGCGGTGAGCATGCGTCTCTCAACGCCATCAACGAC
GCCGTCGCCGACTTCTGCCCCAGATCGCACGCCCACGGCCCCCTAGCGTCGGCCCCGAACCGCTTCTTCCTCGTC
ACCGACTTCGTCGAATTCTCCTCGGCCGCCTCGCCCGGCTCGCGCCTCTCGCTCGCTGCTAAGCTGGCCAAACTG
CACACGACGCCCGCTCCCGTTCCAGCCGGCTATGAAACACCCGTCTTTGGCTTTCCCGTCTCGACTTTCTGCGGC
GAGACGGCCCAGGACAATAGCTGGAAGACGTCGTGGGCCGACTTCTATGCCAACAACCGCCTGCGCGGCATCCTG
CGCGCCTGCGTCGCCAAAAACGGGCCCGACGCCGACCTGGCCGACGCAGTGGAAAAGGTGGCCGTCACTGTCGTC
CCACGCCTCCTCGGTGACGGCCACCTCCACCATCCCATCGTTCCAGTCGTCGTCCACGGCGACCTATGGAACGGC
AATCACGGCACGGGCCGGATAGGAGGCAGGGCTGGCGCTGAGAATGTCGTCTTCGACCCCTCAGCCGCGTACGCC
CACTCAGAATATGAGCTGGGCATCATGCGCATGTTTGGCAGTTTCAGCCCTGACTTCTGGACCGAATACCACAAA
CTCGTCCACAAGGCGGAGCCGGAGGCTGAGTGGGAAGATCGTATCATGCTGTACGAGCTGTATCACCATCTGAAC
CACTTTGCCATCTTCGGTGGCGTCTATCGAGGCGGGGCCATGTCCATCTTGAGAAAGCTCACAGCCAAATATGGC
GGCTAG
Gene >Ophio5|3676
ATGACCTCCAGCTCTGTGGACCCGGCTATCCTCGAGGCTCTGGGGCTCGACGGCGCCCAGACCAAGATGGCCCCG
CACGGCGGCTCCAGCTTCTCGTCGACCTTTAAGCTGACGACGACGACCGACAGTGGAGAGCGGCGGAGTTTGTTC
GTCAAGACGGGCGCCGGCCGCGAGGCAGAACTTATGTTTTGCGGTTCGCGAGAGCGTCCCTGACTTGGGCGTTGG
CCCCTCTACTAATTTCACCAGGTGAGCATGCGTCTCTCAACGCCATCAACGACGCCGTCGCCGACTTCTGCCCCA
GATCGCACGCCCACGGCCCCCTAGCGTCGGCCCCGAACCGCTTCTTCCTCGTCACCGACTTCGTCGAATTCTCCT
CGGCCGCCTCGCCCGGCTCGCGCCTCTCGCTCGCTGCTAAGCTGGCCAAACTGCACACGACGCCCGCTCCCGTTC
CAGCCGGCTATGAAACACCCGTCTTTGGCTTTCCCGTCTCGACTTTCTGCGGCGAGACGGCCCAGGACAATAGCT
GGAAGACGTCGTGGGCCGACTTCTATGCCAACAACCGCCTGCGCGGCATCCTGCGCGCCTGCGTCGCCAAAAACG
GGCCCGACGCCGACCTGGCCGACGCAGTGGAAAAGGTGGCCGTCACTGTCGTCCCACGCCTCCTCGGTGACGGCC
ACCTCCACCATCCCATCGTTCCAGTCGTCGTCCACGGCGACCTATGGAACGGCAATCACGGCACGGGCCGGATAG
GAGGCAGGGCTGGCGCTGAGAATGTCGTCTTCGACCCCTCAGCCGCGTACGCCCACTCAGAATATGAGCTGGGCA
TCATGCGCATGTTTGGCAGTTTCAGCCCTGACTTCTGGACCGAATACCACAAACTCGTCCACAAGGCGGAGCCGG
AGGCTGAGTGGGAAGATCGTATCATGCTGTACGAGCTGTGAGTTGTCCCTTCTTGACGAGAGTTGCCGAATTGGC
ACCGACGTATCGCAACAGGTATCACCATCTGAACCACTTTGCCATCTTCGGTGGCGTCTATCGAGGCGGGGCCAT
GTCCATCTTGAGAAAGCTCACAGCCAAATATGGCGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail