Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3673
Gene name
Locationscaffold_29:64037..64517
Strand+
Gene length (bp)480
Transcript length (bp)480
Coding sequence length (bp)477
Protein length (aa) 159

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain 1.4E-28 55 142

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C6A382|OGT_THESM Methylated-DNA--protein-cysteine methyltransferase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=ogt PE=3 SV=1 42 143 4.0E-16
sp|F0LIT8|OGT_THEBM Methylated-DNA--protein-cysteine methyltransferase OS=Thermococcus barophilus (strain DSM 11836 / MP) GN=ogt PE=3 SV=1 40 143 5.0E-16
sp|O26715|OGT_METTH Methylated-DNA--protein-cysteine methyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ogt PE=3 SV=1 40 145 3.0E-14
sp|C5A3L5|OGT_THEGJ Methylated-DNA--protein-cysteine methyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=ogt PE=3 SV=1 5 143 4.0E-14
sp|O74023|OGT_THEKO Methylated-DNA--protein-cysteine methyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=ogt PE=1 SV=1 54 143 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C6A382|OGT_THESM Methylated-DNA--protein-cysteine methyltransferase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=ogt PE=3 SV=1 42 143 4.0E-16
sp|F0LIT8|OGT_THEBM Methylated-DNA--protein-cysteine methyltransferase OS=Thermococcus barophilus (strain DSM 11836 / MP) GN=ogt PE=3 SV=1 40 143 5.0E-16
sp|O26715|OGT_METTH Methylated-DNA--protein-cysteine methyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ogt PE=3 SV=1 40 145 3.0E-14
sp|C5A3L5|OGT_THEGJ Methylated-DNA--protein-cysteine methyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=ogt PE=3 SV=1 5 143 4.0E-14
sp|O74023|OGT_THEKO Methylated-DNA--protein-cysteine methyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=ogt PE=1 SV=1 54 143 1.0E-13
sp|Q8TI34|OGT_METAC Methylated-DNA--protein-cysteine methyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ogt PE=3 SV=1 34 141 7.0E-13
sp|O27970|OGT_ARCFU Methylated-DNA--protein-cysteine methyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ogt PE=3 SV=1 54 142 2.0E-12
sp|O93728|OGT_PYRAE Methylated-DNA--protein-cysteine methyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=ogt PE=3 SV=2 52 141 4.0E-12
sp|Q58924|OGT_METJA Methylated-DNA--protein-cysteine methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ogt PE=1 SV=1 4 140 9.0E-12
sp|C3N1B4|OGT_SULIA Methylated-DNA--protein-cysteine methyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=ogt PE=3 SV=1 56 146 1.0E-11
sp|P52982|OGT_MYCLE Methylated-DNA--protein-cysteine methyltransferase OS=Mycobacterium leprae (strain TN) GN=ogt PE=3 SV=1 29 139 2.0E-11
sp|Q46EW4|OGT_METBF Methylated-DNA--protein-cysteine methyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=ogt PE=3 SV=1 43 140 2.0E-11
sp|C9RE37|OGT_METVM Methylated-DNA--protein-cysteine methyltransferase OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=ogt PE=3 SV=1 52 143 2.0E-11
sp|C3N9B4|OGT_SULIY Methylated-DNA--protein-cysteine methyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=ogt PE=3 SV=1 56 146 3.0E-11
sp|A4YH39|OGT_METS5 Methylated-DNA--protein-cysteine methyltransferase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=ogt PE=3 SV=1 52 141 3.0E-11
sp|C4KKV8|OGT_SULIK Methylated-DNA--protein-cysteine methyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=ogt PE=3 SV=1 56 146 3.0E-11
sp|C3MKT6|OGT_SULIL Methylated-DNA--protein-cysteine methyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=ogt PE=3 SV=1 56 146 3.0E-11
sp|C3MUC6|OGT_SULIM Methylated-DNA--protein-cysteine methyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=ogt PE=3 SV=1 56 146 3.0E-11
sp|Q97VW7|OGT_SULSO Methylated-DNA--protein-cysteine methyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ogt PE=1 SV=1 56 146 3.0E-11
sp|P11742|OGT_BACSU Methylated-DNA--protein-cysteine methyltransferase, constitutive OS=Bacillus subtilis (strain 168) GN=ogt PE=1 SV=1 34 147 4.0E-11
sp|Q8TZV2|OGT_PYRFU Methylated-DNA--protein-cysteine methyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=ogt PE=3 SV=1 41 108 6.0E-11
sp|Q8PY44|OGT_METMA Methylated-DNA--protein-cysteine methyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=ogt PE=3 SV=1 54 140 7.0E-11
sp|P0A2U0|OGT_SALTY Methylated-DNA--protein-cysteine methyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ogt PE=3 SV=1 37 130 1.0E-10
sp|P0A2U1|OGT_SALTI Methylated-DNA--protein-cysteine methyltransferase OS=Salmonella typhi GN=ogt PE=3 SV=1 37 130 1.0E-10
sp|P44687|OGT_HAEIN Methylated-DNA--protein-cysteine methyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ogt PE=3 SV=2 54 148 1.0E-10
sp|F4HK38|OGT_PYRSN Methylated-DNA--protein-cysteine methyltransferase OS=Pyrococcus sp. (strain NA2) GN=ogt PE=3 SV=1 6 108 2.0E-10
sp|Q5SI16|ATL_THET8 DNA base-flipping protein OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA1564 PE=1 SV=1 3 141 2.0E-10
sp|C3NMY2|OGT_SULIN Methylated-DNA--protein-cysteine methyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=ogt PE=3 SV=1 56 146 2.0E-10
sp|Q6FNR0|MGMT_CANGA Methylated-DNA--protein-cysteine methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MGT1 PE=3 SV=1 54 152 2.0E-10
sp|P9WJW5|OGT_MYCTU Methylated-DNA--protein-cysteine methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ogt PE=1 SV=1 54 134 3.0E-10
sp|P9WJW4|OGT_MYCTO Methylated-DNA--protein-cysteine methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ogt PE=3 SV=1 54 134 3.0E-10
sp|P0A697|OGT_MYCBO Methylated-DNA--protein-cysteine methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ogt PE=3 SV=1 54 134 3.0E-10
sp|O59499|OGT_PYRHO Methylated-DNA--protein-cysteine methyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ogt PE=3 SV=2 54 108 8.0E-10
sp|Q9ZET8|OGT_MYCPA Methylated-DNA--protein-cysteine methyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ogt PE=3 SV=1 54 140 1.0E-09
sp|Q5A0Y8|MGMT_CANAL Methylated-DNA--protein-cysteine methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MGT1 PE=3 SV=1 54 142 2.0E-09
sp|Q9V1N7|OGT_PYRAB Methylated-DNA--protein-cysteine methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ogt PE=3 SV=1 54 108 2.0E-09
sp|Q6KZ38|NFI_PICTO Bifunctional methyltransferase/endonuclease OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO1429 PE=3 SV=1 60 150 2.0E-09
sp|P0AFH1|OGT_SHIFL Methylated-DNA--protein-cysteine methyltransferase OS=Shigella flexneri GN=ogt PE=3 SV=1 34 130 4.0E-09
sp|P0AFH0|OGT_ECOLI Methylated-DNA--protein-cysteine methyltransferase OS=Escherichia coli (strain K12) GN=ogt PE=1 SV=1 34 130 4.0E-09
sp|P19220|ADAB_BACSU Methylated-DNA--protein-cysteine methyltransferase, inducible OS=Bacillus subtilis (strain 168) GN=adaB PE=1 SV=1 54 119 4.0E-09
sp|Q4J9C6|OGT_SULAC Methylated-DNA--protein-cysteine methyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ogt PE=3 SV=1 54 117 6.0E-09
sp|Q973C7|OGT_SULTO Methylated-DNA--protein-cysteine methyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ogt PE=1 SV=1 54 147 6.0E-09
sp|A5E7M8|MGMT_LODEL Methylated-DNA--protein-cysteine methyltransferase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MGT1 PE=3 SV=1 54 118 7.0E-09
sp|P0AFP3|ATL_SHIFL DNA base-flipping protein OS=Shigella flexneri GN=atl PE=3 SV=1 25 150 1.0E-08
sp|P0AFP2|ATL_ECOLI DNA base-flipping protein OS=Escherichia coli (strain K12) GN=atl PE=1 SV=1 25 150 1.0E-08
sp|P26188|MGMT_YEAST Methylated-DNA--protein-cysteine methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGT1 PE=1 SV=3 54 118 2.0E-08
sp|A6ZXD3|MGMT_YEAS7 Methylated-DNA--protein-cysteine methyltransferase OS=Saccharomyces cerevisiae (strain YJM789) GN=MGT1 PE=3 SV=1 54 118 2.0E-08
sp|Q6CPW2|MGMT_KLULA Methylated-DNA--protein-cysteine methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MGT1 PE=3 SV=1 54 140 3.0E-08
sp|P26189|ADA_SALTY Regulatory protein ada OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ada PE=3 SV=2 54 118 5.0E-08
sp|A3LZM4|MGMT_PICST Methylated-DNA--protein-cysteine methyltransferase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MGT1 PE=3 SV=1 54 140 1.0E-07
sp|Q5UNU9|MGMT_MIMIV Probable methylated-DNA--protein-cysteine methyltransferase OS=Acanthamoeba polyphaga mimivirus GN=MGMT PE=3 SV=1 54 108 2.0E-07
sp|Q8TZ11|OGT_METKA Methylated-DNA--protein-cysteine methyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ogt PE=3 SV=1 58 141 6.0E-07
sp|P06134|ADA_ECOLI Bifunctional transcriptional activator/DNA repair enzyme Ada OS=Escherichia coli (strain K12) GN=ada PE=1 SV=2 54 118 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0006281 DNA repair Yes
GO:0003674 molecular_function No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050896 response to stimulus No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0033554 cellular response to stress No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006950 response to stress No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3673
MAGVRKRQMNHVLPGKVPKGSRISTSCAATSLGRACFADETKDSLALIAGSNRTSFEKRVWTALCRIPRGCVTTY
GLLSAHLGSSPRAVGNALRRNPFAPDVPCHRVVATGMTLGGFKGKWPRNGEGITLDEKRRLLKSEGIRFDEKGRV
LGTVWMGWA
Coding >Ophio5|3673
ATGGCAGGCGTTAGGAAGCGACAAATGAACCATGTTCTTCCTGGCAAGGTCCCCAAAGGTTCCAGAATCAGTACC
TCCTGCGCCGCAACGAGTCTGGGAAGAGCGTGTTTCGCGGACGAGACGAAAGATTCACTGGCTCTCATCGCCGGG
TCTAACCGAACCTCCTTCGAGAAGCGCGTTTGGACAGCGCTGTGCCGGATCCCGAGGGGCTGCGTCACCACCTAT
GGCCTGCTCTCGGCTCATCTGGGCTCCTCGCCGCGGGCCGTCGGCAATGCACTGCGACGAAATCCTTTCGCGCCG
GATGTACCCTGCCATCGCGTCGTGGCAACGGGCATGACGCTTGGCGGATTCAAGGGCAAGTGGCCGCGCAATGGC
GAGGGCATCACGCTGGATGAGAAGCGACGGCTGCTGAAGAGCGAGGGCATCAGGTTTGACGAAAAGGGCAGGGTT
CTTGGGACAGTGTGGATGGGATGGGCG
Transcript >Ophio5|3673
ATGGCAGGCGTTAGGAAGCGACAAATGAACCATGTTCTTCCTGGCAAGGTCCCCAAAGGTTCCAGAATCAGTACC
TCCTGCGCCGCAACGAGTCTGGGAAGAGCGTGTTTCGCGGACGAGACGAAAGATTCACTGGCTCTCATCGCCGGG
TCTAACCGAACCTCCTTCGAGAAGCGCGTTTGGACAGCGCTGTGCCGGATCCCGAGGGGCTGCGTCACCACCTAT
GGCCTGCTCTCGGCTCATCTGGGCTCCTCGCCGCGGGCCGTCGGCAATGCACTGCGACGAAATCCTTTCGCGCCG
GATGTACCCTGCCATCGCGTCGTGGCAACGGGCATGACGCTTGGCGGATTCAAGGGCAAGTGGCCGCGCAATGGC
GAGGGCATCACGCTGGATGAGAAGCGACGGCTGCTGAAGAGCGAGGGCATCAGGTTTGACGAAAAGGGCAGGGTT
CTTGGGACAGTGTGGATGGGATGGGCGTAG
Gene >Ophio5|3673
ATGGCAGGCGTTAGGAAGCGACAAATGAACCATGTTCTTCCTGGCAAGGTCCCCAAAGGTTCCAGAATCAGTACC
TCCTGCGCCGCAACGAGTCTGGGAAGAGCGTGTTTCGCGGACGAGACGAAAGATTCACTGGCTCTCATCGCCGGG
TCTAACCGAACCTCCTTCGAGAAGCGCGTTTGGACAGCGCTGTGCCGGATCCCGAGGGGCTGCGTCACCACCTAT
GGCCTGCTCTCGGCTCATCTGGGCTCCTCGCCGCGGGCCGTCGGCAATGCACTGCGACGAAATCCTTTCGCGCCG
GATGTACCCTGCCATCGCGTCGTGGCAACGGGCATGACGCTTGGCGGATTCAAGGGCAAGTGGCCGCGCAATGGC
GAGGGCATCACGCTGGATGAGAAGCGACGGCTGCTGAAGAGCGAGGGCATCAGGTTTGACGAAAAGGGCAGGGTT
CTTGGGACAGTGTGGATGGGATGGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail