Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3669
Gene name
Locationscaffold_29:48984..52710
Strand-
Gene length (bp)3726
Transcript length (bp)3663
Coding sequence length (bp)3660
Protein length (aa) 1220

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00617 RasGEF RasGEF domain 9.8E-53 927 1116
PF00618 RasGEF_N RasGEF N-terminal motif 1.9E-15 748 834

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54PQ4|GEFA_DICDI Ras guanine nucleotide exchange factor A OS=Dictyostelium discoideum GN=gefA PE=2 SV=1 744 1176 8.0E-52
sp|P43069|CDC25_CANAL Cell division control protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC25 PE=3 SV=1 733 1196 1.0E-46
sp|Q02342|CDC25_LACKL Cell division control protein 25 (Fragment) OS=Lachancea kluyveri GN=CDC25 PE=3 SV=1 733 1175 3.0E-46
sp|P04821|CDC25_YEAST Cell division control protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC25 PE=1 SV=1 715 1191 3.0E-46
sp|Q07890|SOS2_HUMAN Son of sevenless homolog 2 OS=Homo sapiens GN=SOS2 PE=1 SV=2 749 1175 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54PQ4|GEFA_DICDI Ras guanine nucleotide exchange factor A OS=Dictyostelium discoideum GN=gefA PE=2 SV=1 744 1176 8.0E-52
sp|P43069|CDC25_CANAL Cell division control protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC25 PE=3 SV=1 733 1196 1.0E-46
sp|Q02342|CDC25_LACKL Cell division control protein 25 (Fragment) OS=Lachancea kluyveri GN=CDC25 PE=3 SV=1 733 1175 3.0E-46
sp|P04821|CDC25_YEAST Cell division control protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC25 PE=1 SV=1 715 1191 3.0E-46
sp|Q07890|SOS2_HUMAN Son of sevenless homolog 2 OS=Homo sapiens GN=SOS2 PE=1 SV=2 749 1175 2.0E-42
sp|Q02384|SOS2_MOUSE Son of sevenless homolog 2 OS=Mus musculus GN=Sos2 PE=1 SV=2 749 1175 4.0E-42
sp|Q62245|SOS1_MOUSE Son of sevenless homolog 1 OS=Mus musculus GN=Sos1 PE=1 SV=2 749 1219 5.0E-42
sp|Q07889|SOS1_HUMAN Son of sevenless homolog 1 OS=Homo sapiens GN=SOS1 PE=1 SV=1 749 1219 6.0E-41
sp|B3LTF3|SDC25_YEAS1 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SDC25 PE=3 SV=1 731 1131 7.0E-41
sp|B5VMS9|SDC25_YEAS6 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SDC25 PE=3 SV=1 731 1131 8.0E-41
sp|A7A0P0|SDC25_YEAS7 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain YJM789) GN=SDC25 PE=3 SV=2 731 1131 8.0E-41
sp|P26675|SOS_DROME Protein son of sevenless OS=Drosophila melanogaster GN=Sos PE=1 SV=2 715 1199 2.0E-40
sp|P0CF34|YL016_YEAST Putative truncated guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDC25 PE=5 SV=1 731 1131 2.0E-40
sp|C8ZCV7|SDC25_YEAS8 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SDC25 PE=3 SV=1 731 1131 2.0E-40
sp|P0CF32|SDC25_YEASX Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae GN=SDC25 PE=3 SV=1 731 1131 4.0E-40
sp|Q8IS14|GEFJ_DICDI Ras guanine nucleotide exchange factor J OS=Dictyostelium discoideum GN=gefJ PE=2 SV=1 748 1175 1.0E-39
sp|Q8IS15|GEFI_DICDI Ras guanine nucleotide exchange factor I OS=Dictyostelium discoideum GN=gefI PE=2 SV=1 748 1175 8.0E-36
sp|A2CEA7|RGRF2_DANRE Ras-specific guanine nucleotide-releasing factor 2 OS=Danio rerio GN=rasgrf2 PE=3 SV=1 813 1177 8.0E-36
sp|Q13972|RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens GN=RASGRF1 PE=1 SV=2 813 1178 4.0E-35
sp|O14827|RGRF2_HUMAN Ras-specific guanine nucleotide-releasing factor 2 OS=Homo sapiens GN=RASGRF2 PE=1 SV=2 813 1177 6.0E-35
sp|Q99JE4|RGRF2_RAT Ras-specific guanine nucleotide-releasing factor 2 OS=Rattus norvegicus GN=Rasgrf2 PE=1 SV=1 813 1177 2.0E-34
sp|P27671|RGRF1_MOUSE Ras-specific guanine nucleotide-releasing factor 1 OS=Mus musculus GN=Rasgrf1 PE=1 SV=2 813 1178 4.0E-34
sp|P70392|RGRF2_MOUSE Ras-specific guanine nucleotide-releasing factor 2 OS=Mus musculus GN=Rasgrf2 PE=1 SV=2 813 1177 5.0E-34
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 738 1146 8.0E-34
sp|P28818|RGRF1_RAT Ras-specific guanine nucleotide-releasing factor 1 OS=Rattus norvegicus GN=Rasgrf1 PE=1 SV=1 813 1178 2.0E-33
sp|Q8SSQ0|GEFR_DICDI Ras guanine nucleotide exchange factor R OS=Dictyostelium discoideum GN=gefR PE=1 SV=1 746 1131 5.0E-33
sp|Q8IS18|GEFE_DICDI Ras guanine nucleotide exchange factor E OS=Dictyostelium discoideum GN=gefE PE=2 SV=1 810 1088 6.0E-33
sp|Q54TK8|GEFP_DICDI Ras guanine nucleotide exchange factor P OS=Dictyostelium discoideum GN=gefP PE=2 SV=1 748 1142 9.0E-33
sp|P26674|STE6_SCHPO Protein ste6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste6 PE=3 SV=1 896 1176 1.0E-31
sp|Q8SSQ3|GEFM_DICDI Ras guanine nucleotide exchange factor M OS=Dictyostelium discoideum GN=gefM PE=2 SV=1 901 1131 2.0E-31
sp|Q552M5|GEFY_DICDI Ras guanine nucleotide exchange factor Y OS=Dictyostelium discoideum GN=gefY PE=1 SV=2 748 1088 3.0E-31
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 747 1131 9.0E-31
sp|Q55GH9|GEFW_DICDI Ras guanine nucleotide exchange factor W OS=Dictyostelium discoideum GN=gefW PE=2 SV=1 703 1131 3.0E-28
sp|Q54FF3|GEFK_DICDI Ras guanine nucleotide exchange factor K OS=Dictyostelium discoideum GN=gefK PE=2 SV=1 912 1175 5.0E-27
sp|Q8IS20|GEFC_DICDI Ras guanine nucleotide exchange factor C OS=Dictyostelium discoideum GN=gefC PE=2 SV=1 919 1131 1.0E-26
sp|Q86G47|GEFQ_DICDI Ras guanine nucleotide exchange factor Q OS=Dictyostelium discoideum GN=gefQ PE=2 SV=1 883 1150 3.0E-26
sp|Q4R7W3|RGPS2_MACFA Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Macaca fascicularis GN=RALGPS2 PE=2 SV=1 920 1204 2.0E-25
sp|Q86X27|RGPS2_HUMAN Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Homo sapiens GN=RALGPS2 PE=1 SV=1 920 1204 2.0E-25
sp|Q9USU1|EFC25_SCHPO Ras guanine nucleotide exchange factor efc25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=efc25 PE=1 SV=1 746 1175 2.0E-25
sp|Q9ERD6|RGPS2_MOUSE Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Mus musculus GN=Ralgps2 PE=1 SV=2 920 1204 4.0E-25
sp|Q5ZJK0|RGPS1_CHICK Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Gallus gallus GN=RALGPS1 PE=2 SV=1 920 1179 7.0E-25
sp|Q8ST25|GEFG_DICDI Ras guanine nucleotide exchange factor G OS=Dictyostelium discoideum GN=gefG PE=2 SV=1 753 1144 2.0E-24
sp|O77086|C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster GN=C3G PE=1 SV=4 748 1135 6.0E-24
sp|A2AR50|RGPS1_MOUSE Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Mus musculus GN=Ralgps1 PE=1 SV=2 920 1217 2.0E-23
sp|F1MSG6|RPGF2_BOVIN Rap guanine nucleotide exchange factor 2 OS=Bos taurus GN=RAPGEF2 PE=1 SV=2 919 1130 2.0E-23
sp|F1PBJ0|RPGF2_CANLF Rap guanine nucleotide exchange factor 2 OS=Canis lupus familiaris GN=RAPGEF2 PE=1 SV=2 919 1130 3.0E-23
sp|Q8SSW7|GEFS_DICDI Ras guanine nucleotide exchange factor S OS=Dictyostelium discoideum GN=gefS PE=2 SV=1 745 1134 3.0E-23
sp|F1M386|RPGF2_RAT Rap guanine nucleotide exchange factor 2 OS=Rattus norvegicus GN=Rapgef2 PE=1 SV=2 919 1130 3.0E-23
sp|Q5JS13|RGPS1_HUMAN Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Homo sapiens GN=RALGPS1 PE=1 SV=1 920 1217 3.0E-23
sp|Q8CHG7|RPGF2_MOUSE Rap guanine nucleotide exchange factor 2 OS=Mus musculus GN=Rapgef2 PE=1 SV=2 919 1130 3.0E-23
sp|Q9Y4G8|RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens GN=RAPGEF2 PE=1 SV=1 919 1130 7.0E-23
sp|Q8IS21|GEFB_DICDI Ras guanine nucleotide exchange factor B OS=Dictyostelium discoideum GN=gefB PE=2 SV=1 927 1178 9.0E-23
sp|Q60695|RGL1_MOUSE Ral guanine nucleotide dissociation stimulator-like 1 OS=Mus musculus GN=Rgl1 PE=1 SV=2 749 1131 4.0E-22
sp|B0UXH6|RGPS1_DANRE Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Danio rerio GN=ralgps1 PE=2 SV=1 920 1180 4.0E-22
sp|Q8TEU7|RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens GN=RAPGEF6 PE=1 SV=2 919 1130 6.0E-22
sp|Q8IS16|GEFH_DICDI Ras guanine nucleotide exchange factor H OS=Dictyostelium discoideum GN=gefH PE=2 SV=1 729 1139 8.0E-22
sp|Q9NZL6|RGL1_HUMAN Ral guanine nucleotide dissociation stimulator-like 1 OS=Homo sapiens GN=RGL1 PE=1 SV=1 749 1131 3.0E-21
sp|Q3UYI5|RGL3_MOUSE Ral guanine nucleotide dissociation stimulator-like 3 OS=Mus musculus GN=Rgl3 PE=1 SV=2 754 1131 3.0E-21
sp|P83900|RPGF5_RAT Rap guanine nucleotide exchange factor 5 OS=Rattus norvegicus GN=Rapgef5 PE=2 SV=1 920 1123 5.0E-21
sp|Q92565|RPGF5_HUMAN Rap guanine nucleotide exchange factor 5 OS=Homo sapiens GN=RAPGEF5 PE=1 SV=1 920 1127 7.0E-21
sp|Q8C0Q9|RPGF5_MOUSE Rap guanine nucleotide exchange factor 5 OS=Mus musculus GN=Rapgef5 PE=2 SV=2 920 1123 9.0E-21
sp|Q6P112|RGL1_DANRE Ral guanine nucleotide dissociation stimulator-like 1 OS=Danio rerio GN=rgl1 PE=2 SV=1 749 1149 1.0E-20
sp|Q54S40|GBPD_DICDI Cyclic GMP-binding protein D OS=Dictyostelium discoideum GN=gbpD PE=2 SV=1 925 1091 2.0E-20
sp|Q8IS11|GEFO_DICDI Ras guanine nucleotide exchange factor O OS=Dictyostelium discoideum GN=gefO PE=2 SV=1 886 1150 4.0E-19
sp|G5EDB9|RPGF_CAEEL Rap guanine nucleotide exchange factor OS=Caenorhabditis elegans GN=pxf-1 PE=1 SV=1 928 1172 6.0E-19
sp|Q6DBW1|RG1BB_DANRE Ras-GEF domain-containing family member 1B-B OS=Danio rerio GN=rasgef1bb PE=2 SV=1 745 1127 1.0E-18
sp|Q3MIN7|RGL3_HUMAN Ral guanine nucleotide dissociation stimulator-like 3 OS=Homo sapiens GN=RGL3 PE=1 SV=2 916 1131 9.0E-18
sp|Q6DHR3|RG1BA_DANRE Ras-GEF domain-containing family member 1B-A OS=Danio rerio GN=rasgef1ba PE=2 SV=2 739 1088 2.0E-17
sp|Q03385|GNDS_MOUSE Ral guanine nucleotide dissociation stimulator OS=Mus musculus GN=Ralgds PE=1 SV=2 894 1131 3.0E-17
sp|Q03386|GNDS_RAT Ral guanine nucleotide dissociation stimulator OS=Rattus norvegicus GN=Ralgds PE=1 SV=1 894 1131 6.0E-17
sp|Q13905|RPGF1_HUMAN Rap guanine nucleotide exchange factor 1 OS=Homo sapiens GN=RAPGEF1 PE=1 SV=3 922 1131 9.0E-17
sp|A0JM95|RGF1A_XENTR Ras-GEF domain-containing family member 1A OS=Xenopus tropicalis GN=rasgef1a PE=2 SV=1 745 1085 1.0E-16
sp|P0C643|GRP2_RAT RAS guanyl-releasing protein 2 OS=Rattus norvegicus GN=Rasgrp2 PE=1 SV=1 923 1090 2.0E-16
sp|A6N9I4|GRP2_BOVIN RAS guanyl-releasing protein 2 OS=Bos taurus GN=RASGRP2 PE=2 SV=1 923 1090 2.0E-16
sp|Q7LDG7|GRP2_HUMAN RAS guanyl-releasing protein 2 OS=Homo sapiens GN=RASGRP2 PE=1 SV=1 923 1090 2.0E-16
sp|Q9QUG9|GRP2_MOUSE RAS guanyl-releasing protein 2 OS=Mus musculus GN=Rasgrp2 PE=1 SV=2 923 1090 2.0E-16
sp|O95398|RPGF3_HUMAN Rap guanine nucleotide exchange factor 3 OS=Homo sapiens GN=RAPGEF3 PE=1 SV=6 927 1089 5.0E-16
sp|Q9UHV5|RPGFL_HUMAN Rap guanine nucleotide exchange factor-like 1 OS=Homo sapiens GN=RAPGEFL1 PE=1 SV=2 923 1089 6.0E-16
sp|Q5R9B2|RPGFL_PONPY Rap guanine nucleotide exchange factor-like 1 OS=Pongo pygmaeus GN=RAPGEFL1 PE=2 SV=1 923 1089 1.0E-15
sp|Q9Z1C8|RPGF3_RAT Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus GN=Rapgef3 PE=2 SV=2 927 1120 2.0E-15
sp|Q12967|GNDS_HUMAN Ral guanine nucleotide dissociation stimulator OS=Homo sapiens GN=RALGDS PE=1 SV=2 918 1131 2.0E-15
sp|Q95KH6|RGF1C_MACFA Ras-GEF domain-containing family member 1C OS=Macaca fascicularis GN=RASGEF1C PE=2 SV=1 746 1144 3.0E-15
sp|Q32N25|GRP2A_XENLA RAS guanyl-releasing protein 2-A OS=Xenopus laevis GN=rasgrp2-a PE=2 SV=1 923 1178 3.0E-15
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 920 1131 5.0E-15
sp|Q68EF8|RPGFL_MOUSE Rap guanine nucleotide exchange factor-like 1 OS=Mus musculus GN=Rapgefl1 PE=1 SV=2 923 1089 6.0E-15
sp|Q8MVR1|GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum GN=gbpC PE=1 SV=1 924 1100 8.0E-15
sp|O15211|RGL2_HUMAN Ral guanine nucleotide dissociation stimulator-like 2 OS=Homo sapiens GN=RGL2 PE=1 SV=1 748 1145 1.0E-14
sp|Q8VCC8|RPGF3_MOUSE Rap guanine nucleotide exchange factor 3 OS=Mus musculus GN=Rapgef3 PE=1 SV=2 972 1120 1.0E-14
sp|Q6DCK3|GRP2B_XENLA RAS guanyl-releasing protein 2-B OS=Xenopus laevis GN=rasgrp2-b PE=2 SV=1 923 1175 1.0E-14
sp|Q9D300|RGF1C_MOUSE Ras-GEF domain-containing family member 1C OS=Mus musculus GN=Rasgef1c PE=2 SV=1 746 1144 1.0E-14
sp|Q8WZA2|RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens GN=RAPGEF4 PE=1 SV=1 927 1089 1.0E-14
sp|A4IFE4|RGF1B_BOVIN Ras-GEF domain-containing family member 1B OS=Bos taurus GN=RASGEF1B PE=2 SV=1 742 1140 2.0E-14
sp|Q61193|RGL2_MOUSE Ral guanine nucleotide dissociation stimulator-like 2 OS=Mus musculus GN=Rgl2 PE=1 SV=2 928 1145 2.0E-14
sp|Q28EC1|RGF1B_XENTR Ras-GEF domain-containing family member 1B OS=Xenopus tropicalis GN=rasgef1b PE=2 SV=1 742 1140 3.0E-14
sp|Q8N9B8|RGF1A_HUMAN Ras-GEF domain-containing family member 1A OS=Homo sapiens GN=RASGEF1A PE=2 SV=2 740 1085 3.0E-14
sp|Q5RC04|RGF1B_PONAB Ras-GEF domain-containing family member 1B OS=Pongo abelii GN=RASGEF1B PE=2 SV=2 742 1140 3.0E-14
sp|Q8N431|RGF1C_HUMAN Ras-GEF domain-containing family member 1C OS=Homo sapiens GN=RASGEF1C PE=2 SV=2 746 1144 3.0E-14
sp|Q9EQZ6|RPGF4_MOUSE Rap guanine nucleotide exchange factor 4 OS=Mus musculus GN=Rapgef4 PE=1 SV=1 987 1089 4.0E-14
sp|Q8IZJ4|RGDSR_HUMAN Ral-GDS-related protein OS=Homo sapiens GN=RGL4 PE=2 SV=1 918 1177 5.0E-14
sp|Q9Z1C7|RPGF4_RAT Rap guanine nucleotide exchange factor 4 (Fragment) OS=Rattus norvegicus GN=Rapgef4 PE=2 SV=1 927 1089 6.0E-14
sp|Q0VAM2|RGF1B_HUMAN Ras-GEF domain-containing family member 1B OS=Homo sapiens GN=RASGEF1B PE=1 SV=2 742 1140 7.0E-14
sp|Q5TJE5|RGL2_CANLF Ral guanine nucleotide dissociation stimulator-like 2 OS=Canis lupus familiaris GN=RGL2 PE=3 SV=1 928 1145 2.0E-13
sp|Q8JZL7|RGF1B_MOUSE Ras-GEF domain-containing family member 1B OS=Mus musculus GN=Rasgef1b PE=1 SV=1 742 1140 2.0E-13
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 719 1136 3.0E-13
sp|Q8IS12|GEFN_DICDI Ras guanine nucleotide exchange factor N OS=Dictyostelium discoideum GN=gefN PE=2 SV=1 757 1130 1.0E-12
sp|Q6CY10|LTE1_KLULA Guanine nucleotide exchange factor LTE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LTE1 PE=3 SV=1 918 1084 3.0E-12
sp|Q8IS19|GEFD_DICDI Ras guanine nucleotide exchange factor D OS=Dictyostelium discoideum GN=gefD PE=2 SV=1 928 1133 3.0E-12
sp|Q6FT12|LTE1_CANGA Guanine nucleotide exchange factor LTE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LTE1 PE=3 SV=1 908 1084 3.0E-12
sp|Q6NTL4|GRP1_XENLA RAS guanyl-releasing protein 1 OS=Xenopus laevis GN=rasgrp1 PE=2 SV=1 923 1082 1.0E-11
sp|A4IJ06|GRP1_XENTR RAS guanyl-releasing protein 1 OS=Xenopus tropicalis GN=rasgrp1 PE=2 SV=1 923 1082 5.0E-11
sp|P07866|LTE1_YEAST Guanine nucleotide exchange factor LTE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LTE1 PE=1 SV=2 917 1131 1.0E-10
sp|Q75BH9|LTE1_ASHGO Guanine nucleotide exchange factor LTE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LTE1 PE=3 SV=1 918 1131 2.0E-10
sp|Q1LZ97|GRP4_BOVIN RAS guanyl-releasing protein 4 OS=Bos taurus GN=RASGRP4 PE=2 SV=1 923 1090 7.0E-10
sp|P25300|BUD5_YEAST Bud site selection protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD5 PE=1 SV=2 921 1131 8.0E-10
sp|O95267|GRP1_HUMAN RAS guanyl-releasing protein 1 OS=Homo sapiens GN=RASGRP1 PE=1 SV=2 923 1082 9.0E-10
sp|Q8IV61|GRP3_HUMAN Ras guanyl-releasing protein 3 OS=Homo sapiens GN=RASGRP3 PE=1 SV=1 915 1090 1.0E-09
sp|Q8BTM9|GRP4_MOUSE RAS guanyl-releasing protein 4 OS=Mus musculus GN=Rasgrp4 PE=1 SV=1 923 1090 1.0E-09
sp|Q8TDF6|GRP4_HUMAN RAS guanyl-releasing protein 4 OS=Homo sapiens GN=RASGRP4 PE=1 SV=2 923 1090 2.0E-09
sp|P34578|RPGF1_CAEEL Rap guanine nucleotide exchange factor 1 OS=Caenorhabditis elegans GN=epac-1 PE=3 SV=3 989 1124 2.0E-09
sp|Q9R1K8|GRP1_RAT RAS guanyl-releasing protein 1 OS=Rattus norvegicus GN=Rasgrp1 PE=1 SV=1 923 1082 6.0E-09
sp|Q9Z1S3|GRP1_MOUSE RAS guanyl-releasing protein 1 OS=Mus musculus GN=Rasgrp1 PE=1 SV=1 923 1082 6.0E-09
sp|Q8R5I4|GRP4_RAT RAS guanyl-releasing protein 4 OS=Rattus norvegicus GN=Rasgrp4 PE=1 SV=1 923 1090 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0007264 small GTPase mediated signal transduction Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0007165 signal transduction No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0035556 intracellular signal transduction No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0003674 molecular_function No
GO:0030234 enzyme regulator activity No
GO:0098772 molecular function regulator activity No
GO:0050794 regulation of cellular process No
GO:0030695 GTPase regulator activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3669
MLSDDVVRASLCVAPLDIAQAQAANGSSYPSQLPNNLYMQSQMTPPATPNSSQEDLSPDEAADPPVFNSFLRAFF
PFTPSGAMTESSVTIALNEGDVVLVHSVHTNGWADGTLLASGARGWLPTNYCSPYYPEPIRSLLKSLLNFWDLLR
SAAVDDNEIFKNQEYIKGIIAGVRFLLDRSGLLARESVVAHCDALRKARRVLLYELSQLVKTAKRLQERQGGTLE
PAEDVNDIIDEMILKAFRIVTKGVCFLDIFEEEKKSCDATTVNSTGTATEQLYVPPTPPADQTNFDHGQGPGTDD
AASRDATVEPTASVETSALQAPSAAGPWGKRLSSLQAPAHDAHASAAQKRLSHASVRRSRRLSGSMAHRVSLAGP
SPLSRPHHLASERLSRSHDKFLSYLGSFIGRLNLQSHSRPGLALAVKLSATSGGELVAVIDGVCGYNSSNFSALG
QVRAAMFERIQALVLSARHILGHTPSEESSDIILPHDNNTLLTAATGCVRAAGECVAKAKAAVERAGDFEIELPE
NGLELDLSALDAVIQDRSRTPSVTERSDTATVEPSSNLSEPSAARHKRPTISTVDKPLPRVPKLSIPTDQHLHLN
PSPASSGPCASVNEDAFSSAASSVSSTRPSTRNLPGYLHHPASHVVADHMVGPGGSRHDADVHASRFDSLAASSA
GSTTTYLSRDSETSIVSQTSTRATTPDHGLVPRSKPSMSELSSFSHVDDADDVEARLLERTYAHELMFNKEGQVT
GGSLPALVERLTTHESTPDAAFVSTFYLTFRLFCTPVKLTEALIDRFDYVGESPHMAVPVRLRVYNVFKGWLESH
WRDRTDREALKLVIPFAEQKLGAVLSSAGRRLLELAKRVSSDKSLVPRLVSSMGKTNTAIGPYVPADTPVPHPAI
SKSQLHALSAFRAGGNAPSIVDLEPLELARQLTVRQMSIFCSILPEELLASQWMKKGGVDAPHVKAMSSLSTDLS
NLVAETVLQHPEIKKRAAVIKQWIKIANHCHELHNYDGLMAIICSLNSSTISRLRKTWDAVSPKRKEVLRALQDL
VEPSQNHKVLRTRLHDHVPPCLPFLGMYLTDLTFVDIGNPATKHMSLGGESDDSSAGGLTVVNFDKHCRTAKIIG
ELQRFQIPYRLLEVPDMQEWWAAQIRRVRAGDQGKVQVTYYRKSLLLEPREPTPRRDHHDPAAPATSGSTAPSRP
DLFGWMSRDRGGQTPTPAQV
Coding >Ophio5|3669
ATGCTGAGCGACGACGTCGTCCGAGCCAGTCTCTGCGTGGCCCCCCTCGACATAGCCCAAGCCCAGGCTGCAAAT
GGCTCGAGCTATCCTTCTCAACTCCCGAACAACCTCTACATGCAATCCCAAATGACGCCTCCCGCAACCCCAAAC
AGCTCCCAGGAGGACCTGTCGCCCGACGAGGCCGCCGACCCGCCTGTCTTCAACAGCTTCCTGCGGGCCTTCTTT
CCCTTCACCCCCAGCGGTGCCATGACCGAGTCTAGCGTCACCATCGCACTGAACGAGGGAGACGTCGTTCTGGTG
CACTCGGTCCACACTAATGGATGGGCGGACGGCACTCTGCTCGCCTCGGGCGCAAGGGGATGGCTGCCCACCAAC
TACTGCAGCCCCTACTATCCCGAACCTATCCGCAGCCTGCTCAAGTCTCTGCTCAACTTTTGGGACTTGTTGCGG
AGCGCGGCCGTCGATGACAATGAGATATTCAAGAATCAAGAGTACATCAAGGGCATCATTGCCGGTGTACGCTTT
CTCCTGGATCGCTCCGGTCTCCTGGCTAGAGAGTCCGTTGTCGCCCACTGTGACGCCCTCCGGAAAGCCCGAAGA
GTGTTGCTCTACGAATTGTCGCAGCTGGTCAAGACTGCGAAACGGCTACAAGAGCGTCAGGGAGGAACCCTCGAG
CCCGCGGAGGACGTAAACGACATCATCGACGAGATGATCCTCAAGGCCTTCAGGATTGTCACAAAAGGCGTCTGC
TTCCTCGACATTTTCGAGGAAGAAAAGAAGTCATGTGACGCGACCACGGTCAACTCGACAGGCACGGCGACAGAG
CAGCTGTACGTGCCGCCCACGCCTCCGGCTGACCAGACCAACTTCGATCATGGCCAAGGTCCCGGGACCGATGAC
GCGGCCTCCCGTGACGCCACGGTCGAGCCGACGGCATCGGTTGAGACATCGGCCCTGCAGGCCCCCTCGGCGGCA
GGCCCCTGGGGCAAGCGCCTGTCGTCACTCCAAGCGCCCGCTCACGACGCCCACGCGAGCGCTGCTCAGAAGCGG
CTGTCCCATGCGAGCGTGCGCCGGAGCCGTCGTCTGTCAGGCTCCATGGCCCACCGCGTTTCTCTGGCCGGGCCT
TCGCCCCTTTCGCGACCTCATCACCTCGCGTCGGAACGACTCAGCCGGAGCCACGACAAGTTTCTCTCCTACCTC
GGCTCCTTTATCGGAAGACTGAATCTCCAATCGCACTCTCGTCCCGGGCTTGCCCTCGCCGTCAAGTTGTCGGCC
ACATCTGGAGGCGAGCTCGTCGCTGTTATTGACGGCGTCTGTGGCTACAACAGCTCCAACTTCAGCGCCCTCGGC
CAGGTCCGTGCCGCCATGTTCGAGCGAATTCAGGCCCTGGTCCTGTCGGCCCGCCATATCCTGGGTCATACCCCC
AGCGAGGAGAGCTCGGACATTATCCTGCCTCACGACAACAATACGCTGCTCACGGCCGCAACCGGATGCGTCCGG
GCGGCCGGCGAGTGCGTAGCCAAGGCCAAGGCGGCCGTCGAGAGGGCGGGCGACTTTGAGATTGAGCTGCCAGAA
AACGGCCTCGAGCTGGACCTCAGCGCCCTCGATGCCGTCATACAGGATCGTTCCCGCACCCCGTCCGTCACCGAA
CGATCCGACACGGCCACCGTCGAGCCCTCCTCCAACCTCTCCGAGCCATCAGCTGCGAGGCATAAGCGGCCGACC
ATAAGCACCGTCGACAAACCTCTACCCCGAGTGCCCAAGCTGAGCATCCCCACGGATCAGCACCTTCACCTGAAC
CCTTCACCGGCGTCGTCCGGGCCGTGCGCCTCGGTCAACGAGGACGCCTTCTCGAGCGCGGCCTCGTCCGTCTCG
TCGACACGCCCTTCGACGCGGAATCTGCCCGGCTACTTGCATCACCCTGCATCACACGTCGTCGCTGATCACATG
GTAGGGCCCGGTGGCTCGAGGCACGATGCCGACGTACACGCTTCGCGATTTGATTCGCTCGCCGCCTCGAGCGCC
GGCAGCACCACGACGTACCTCAGCCGAGACTCGGAAACTAGCATCGTGTCGCAGACGTCGACGCGGGCCACGACG
CCCGACCACGGCCTCGTGCCGCGCAGCAAGCCGTCCATGTCGGAGCTCAGCAGCTTCTCGCACGTCGACGATGCC
GACGACGTCGAGGCCAGGCTGCTTGAGAGGACGTATGCCCACGAGCTCATGTTCAATAAGGAGGGCCAGGTTACG
GGCGGCTCCTTGCCCGCGCTCGTTGAGCGCCTCACGACGCACGAGTCAACGCCCGATGCCGCCTTCGTCTCAACG
TTCTACCTGACCTTCCGCCTCTTCTGCACGCCCGTCAAGTTGACGGAAGCTCTCATTGACCGCTTCGACTATGTT
GGCGAGTCCCCTCACATGGCGGTACCGGTCCGGCTCAGAGTGTACAACGTCTTTAAAGGCTGGCTCGAGTCCCAC
TGGAGGGACCGCACCGACCGGGAGGCGCTTAAACTCGTCATCCCCTTCGCCGAGCAGAAGCTCGGCGCCGTCCTC
TCCTCGGCCGGTCGCCGTCTGCTCGAGCTGGCCAAGCGGGTTTCGAGCGACAAATCGCTGGTGCCCCGGCTGGTG
TCTTCGATGGGAAAGACAAACACGGCCATCGGGCCGTATGTGCCGGCGGACACACCGGTGCCACATCCGGCCATC
TCCAAGAGCCAGCTGCACGCACTCAGCGCCTTCCGGGCCGGGGGAAACGCGCCGTCGATTGTCGACCTGGAGCCG
CTGGAGCTCGCGCGCCAGTTGACGGTTCGGCAGATGAGCATCTTCTGCTCCATTCTGCCGGAGGAGCTACTCGCG
TCGCAGTGGATGAAGAAGGGCGGCGTGGACGCGCCTCACGTCAAGGCCATGTCGTCGCTGTCGACGGACCTCTCG
AACCTGGTGGCCGAGACGGTGCTTCAGCATCCGGAGATCAAGAAGCGCGCGGCCGTCATCAAGCAGTGGATCAAA
ATTGCCAACCACTGCCACGAGCTGCACAACTACGACGGGCTGATGGCCATCATCTGCAGCCTCAACAGCAGCACC
ATCAGCCGCCTGCGCAAGACGTGGGACGCCGTGTCGCCCAAGCGCAAGGAGGTGCTTCGCGCTCTGCAGGACCTG
GTCGAGCCGTCGCAGAACCACAAGGTGCTGCGGACGAGGCTCCACGATCACGTCCCGCCCTGTCTGCCCTTCCTC
GGCATGTATCTGACGGACCTGACGTTTGTCGACATCGGCAACCCGGCGACCAAGCACATGTCGCTCGGCGGAGAG
TCGGACGACTCCAGCGCCGGCGGCCTGACGGTTGTCAACTTTGATAAGCACTGCCGTACCGCCAAGATCATTGGC
GAGCTGCAGCGCTTCCAGATCCCCTACCGGCTGCTCGAGGTGCCGGACATGCAGGAGTGGTGGGCGGCGCAGATC
CGACGGGTTCGCGCCGGCGACCAGGGCAAGGTCCAGGTCACGTACTACCGCAAGAGCCTGCTCCTCGAGCCCCGA
GAGCCGACTCCGCGACGGGATCATCACGATCCGGCGGCGCCCGCGACGTCGGGCTCGACGGCCCCATCCCGGCCG
GACCTCTTCGGTTGGATGTCTCGCGACCGGGGCGGCCAGACGCCGACGCCGGCTCAGGTG
Transcript >Ophio5|3669
ATGCTGAGCGACGACGTCGTCCGAGCCAGTCTCTGCGTGGCCCCCCTCGACATAGCCCAAGCCCAGGCTGCAAAT
GGCTCGAGCTATCCTTCTCAACTCCCGAACAACCTCTACATGCAATCCCAAATGACGCCTCCCGCAACCCCAAAC
AGCTCCCAGGAGGACCTGTCGCCCGACGAGGCCGCCGACCCGCCTGTCTTCAACAGCTTCCTGCGGGCCTTCTTT
CCCTTCACCCCCAGCGGTGCCATGACCGAGTCTAGCGTCACCATCGCACTGAACGAGGGAGACGTCGTTCTGGTG
CACTCGGTCCACACTAATGGATGGGCGGACGGCACTCTGCTCGCCTCGGGCGCAAGGGGATGGCTGCCCACCAAC
TACTGCAGCCCCTACTATCCCGAACCTATCCGCAGCCTGCTCAAGTCTCTGCTCAACTTTTGGGACTTGTTGCGG
AGCGCGGCCGTCGATGACAATGAGATATTCAAGAATCAAGAGTACATCAAGGGCATCATTGCCGGTGTACGCTTT
CTCCTGGATCGCTCCGGTCTCCTGGCTAGAGAGTCCGTTGTCGCCCACTGTGACGCCCTCCGGAAAGCCCGAAGA
GTGTTGCTCTACGAATTGTCGCAGCTGGTCAAGACTGCGAAACGGCTACAAGAGCGTCAGGGAGGAACCCTCGAG
CCCGCGGAGGACGTAAACGACATCATCGACGAGATGATCCTCAAGGCCTTCAGGATTGTCACAAAAGGCGTCTGC
TTCCTCGACATTTTCGAGGAAGAAAAGAAGTCATGTGACGCGACCACGGTCAACTCGACAGGCACGGCGACAGAG
CAGCTGTACGTGCCGCCCACGCCTCCGGCTGACCAGACCAACTTCGATCATGGCCAAGGTCCCGGGACCGATGAC
GCGGCCTCCCGTGACGCCACGGTCGAGCCGACGGCATCGGTTGAGACATCGGCCCTGCAGGCCCCCTCGGCGGCA
GGCCCCTGGGGCAAGCGCCTGTCGTCACTCCAAGCGCCCGCTCACGACGCCCACGCGAGCGCTGCTCAGAAGCGG
CTGTCCCATGCGAGCGTGCGCCGGAGCCGTCGTCTGTCAGGCTCCATGGCCCACCGCGTTTCTCTGGCCGGGCCT
TCGCCCCTTTCGCGACCTCATCACCTCGCGTCGGAACGACTCAGCCGGAGCCACGACAAGTTTCTCTCCTACCTC
GGCTCCTTTATCGGAAGACTGAATCTCCAATCGCACTCTCGTCCCGGGCTTGCCCTCGCCGTCAAGTTGTCGGCC
ACATCTGGAGGCGAGCTCGTCGCTGTTATTGACGGCGTCTGTGGCTACAACAGCTCCAACTTCAGCGCCCTCGGC
CAGGTCCGTGCCGCCATGTTCGAGCGAATTCAGGCCCTGGTCCTGTCGGCCCGCCATATCCTGGGTCATACCCCC
AGCGAGGAGAGCTCGGACATTATCCTGCCTCACGACAACAATACGCTGCTCACGGCCGCAACCGGATGCGTCCGG
GCGGCCGGCGAGTGCGTAGCCAAGGCCAAGGCGGCCGTCGAGAGGGCGGGCGACTTTGAGATTGAGCTGCCAGAA
AACGGCCTCGAGCTGGACCTCAGCGCCCTCGATGCCGTCATACAGGATCGTTCCCGCACCCCGTCCGTCACCGAA
CGATCCGACACGGCCACCGTCGAGCCCTCCTCCAACCTCTCCGAGCCATCAGCTGCGAGGCATAAGCGGCCGACC
ATAAGCACCGTCGACAAACCTCTACCCCGAGTGCCCAAGCTGAGCATCCCCACGGATCAGCACCTTCACCTGAAC
CCTTCACCGGCGTCGTCCGGGCCGTGCGCCTCGGTCAACGAGGACGCCTTCTCGAGCGCGGCCTCGTCCGTCTCG
TCGACACGCCCTTCGACGCGGAATCTGCCCGGCTACTTGCATCACCCTGCATCACACGTCGTCGCTGATCACATG
GTAGGGCCCGGTGGCTCGAGGCACGATGCCGACGTACACGCTTCGCGATTTGATTCGCTCGCCGCCTCGAGCGCC
GGCAGCACCACGACGTACCTCAGCCGAGACTCGGAAACTAGCATCGTGTCGCAGACGTCGACGCGGGCCACGACG
CCCGACCACGGCCTCGTGCCGCGCAGCAAGCCGTCCATGTCGGAGCTCAGCAGCTTCTCGCACGTCGACGATGCC
GACGACGTCGAGGCCAGGCTGCTTGAGAGGACGTATGCCCACGAGCTCATGTTCAATAAGGAGGGCCAGGTTACG
GGCGGCTCCTTGCCCGCGCTCGTTGAGCGCCTCACGACGCACGAGTCAACGCCCGATGCCGCCTTCGTCTCAACG
TTCTACCTGACCTTCCGCCTCTTCTGCACGCCCGTCAAGTTGACGGAAGCTCTCATTGACCGCTTCGACTATGTT
GGCGAGTCCCCTCACATGGCGGTACCGGTCCGGCTCAGAGTGTACAACGTCTTTAAAGGCTGGCTCGAGTCCCAC
TGGAGGGACCGCACCGACCGGGAGGCGCTTAAACTCGTCATCCCCTTCGCCGAGCAGAAGCTCGGCGCCGTCCTC
TCCTCGGCCGGTCGCCGTCTGCTCGAGCTGGCCAAGCGGGTTTCGAGCGACAAATCGCTGGTGCCCCGGCTGGTG
TCTTCGATGGGAAAGACAAACACGGCCATCGGGCCGTATGTGCCGGCGGACACACCGGTGCCACATCCGGCCATC
TCCAAGAGCCAGCTGCACGCACTCAGCGCCTTCCGGGCCGGGGGAAACGCGCCGTCGATTGTCGACCTGGAGCCG
CTGGAGCTCGCGCGCCAGTTGACGGTTCGGCAGATGAGCATCTTCTGCTCCATTCTGCCGGAGGAGCTACTCGCG
TCGCAGTGGATGAAGAAGGGCGGCGTGGACGCGCCTCACGTCAAGGCCATGTCGTCGCTGTCGACGGACCTCTCG
AACCTGGTGGCCGAGACGGTGCTTCAGCATCCGGAGATCAAGAAGCGCGCGGCCGTCATCAAGCAGTGGATCAAA
ATTGCCAACCACTGCCACGAGCTGCACAACTACGACGGGCTGATGGCCATCATCTGCAGCCTCAACAGCAGCACC
ATCAGCCGCCTGCGCAAGACGTGGGACGCCGTGTCGCCCAAGCGCAAGGAGGTGCTTCGCGCTCTGCAGGACCTG
GTCGAGCCGTCGCAGAACCACAAGGTGCTGCGGACGAGGCTCCACGATCACGTCCCGCCCTGTCTGCCCTTCCTC
GGCATGTATCTGACGGACCTGACGTTTGTCGACATCGGCAACCCGGCGACCAAGCACATGTCGCTCGGCGGAGAG
TCGGACGACTCCAGCGCCGGCGGCCTGACGGTTGTCAACTTTGATAAGCACTGCCGTACCGCCAAGATCATTGGC
GAGCTGCAGCGCTTCCAGATCCCCTACCGGCTGCTCGAGGTGCCGGACATGCAGGAGTGGTGGGCGGCGCAGATC
CGACGGGTTCGCGCCGGCGACCAGGGCAAGGTCCAGGTCACGTACTACCGCAAGAGCCTGCTCCTCGAGCCCCGA
GAGCCGACTCCGCGACGGGATCATCACGATCCGGCGGCGCCCGCGACGTCGGGCTCGACGGCCCCATCCCGGCCG
GACCTCTTCGGTTGGATGTCTCGCGACCGGGGCGGCCAGACGCCGACGCCGGCTCAGGTGTGA
Gene >Ophio5|3669
ATGCTGAGCGACGACGTCGTCCGAGCCAGTCTCTGCGTGGCCCCCCTCGACATAGCCCAAGCCCAGGCTGCAAAT
GGCTCGAGCTATCCTTCTCAACTCCCGAACAACCTCTACATGCAATCCCAAATGACGCCTCCCGCAACCCCAAAC
AGCTCCCAGGAGGACCTGTCGCCCGACGAGGCCGCCGACCCGCCTGTCTTCAACAGCTTCCTGCGGGCCTTCTTT
CCCTTCACCCCCAGCGGTGCCATGACCGAGTCTAGCGTCACCATCGCACTGAACGAGGGAGACGTCGTTCTGGTG
CACTCGGTCCACACTAATGGATGGGCGGACGGCACTCTGCTCGCCTCGGGCGCAAGGGGATGGCTGCCCACCAAC
TACTGCAGCCCCTACTATCCCGAACCTATCCGCAGCCTGCTCAAGTCTCTGCTCAACTTTTGGGACTTGTTGCGG
AGCGCGGCCGTCGATGACAATGAGATATTCAAGAATCAAGAGTACATCAAGGGCATCATTGCCGGTGTACGCTTT
CTCCTGGTTCGTTGACGTCATTCTCCCCAACATTTCAGCCTTCATCTCTCTAATGACTTTTCTATCCAGGATCGC
TCCGGTCTCCTGGCTAGAGAGTCCGTTGTCGCCCACTGTGACGCCCTCCGGAAAGCCCGAAGAGTGTTGCTCTAC
GAATTGTCGCAGCTGGTCAAGACTGCGAAACGGCTACAAGAGCGTCAGGGAGGAACCCTCGAGCCCGCGGAGGAC
GTAAACGACATCATCGACGAGATGATCCTCAAGGCCTTCAGGATTGTCACAAAAGGCGTCTGCTTCCTCGACATT
TTCGAGGAAGAAAAGAAGTCATGTGACGCGACCACGGTCAACTCGACAGGCACGGCGACAGAGCAGCTGTACGTG
CCGCCCACGCCTCCGGCTGACCAGACCAACTTCGATCATGGCCAAGGTCCCGGGACCGATGACGCGGCCTCCCGT
GACGCCACGGTCGAGCCGACGGCATCGGTTGAGACATCGGCCCTGCAGGCCCCCTCGGCGGCAGGCCCCTGGGGC
AAGCGCCTGTCGTCACTCCAAGCGCCCGCTCACGACGCCCACGCGAGCGCTGCTCAGAAGCGGCTGTCCCATGCG
AGCGTGCGCCGGAGCCGTCGTCTGTCAGGCTCCATGGCCCACCGCGTTTCTCTGGCCGGGCCTTCGCCCCTTTCG
CGACCTCATCACCTCGCGTCGGAACGACTCAGCCGGAGCCACGACAAGTTTCTCTCCTACCTCGGCTCCTTTATC
GGAAGACTGAATCTCCAATCGCACTCTCGTCCCGGGCTTGCCCTCGCCGTCAAGTTGTCGGCCACATCTGGAGGC
GAGCTCGTCGCTGTTATTGACGGCGTCTGTGGCTACAACAGCTCCAACTTCAGCGCCCTCGGCCAGGTCCGTGCC
GCCATGTTCGAGCGAATTCAGGCCCTGGTCCTGTCGGCCCGCCATATCCTGGGTCATACCCCCAGCGAGGAGAGC
TCGGACATTATCCTGCCTCACGACAACAATACGCTGCTCACGGCCGCAACCGGATGCGTCCGGGCGGCCGGCGAG
TGCGTAGCCAAGGCCAAGGCGGCCGTCGAGAGGGCGGGCGACTTTGAGATTGAGCTGCCAGAAAACGGCCTCGAG
CTGGACCTCAGCGCCCTCGATGCCGTCATACAGGATCGTTCCCGCACCCCGTCCGTCACCGAACGATCCGACACG
GCCACCGTCGAGCCCTCCTCCAACCTCTCCGAGCCATCAGCTGCGAGGCATAAGCGGCCGACCATAAGCACCGTC
GACAAACCTCTACCCCGAGTGCCCAAGCTGAGCATCCCCACGGATCAGCACCTTCACCTGAACCCTTCACCGGCG
TCGTCCGGGCCGTGCGCCTCGGTCAACGAGGACGCCTTCTCGAGCGCGGCCTCGTCCGTCTCGTCGACACGCCCT
TCGACGCGGAATCTGCCCGGCTACTTGCATCACCCTGCATCACACGTCGTCGCTGATCACATGGTAGGGCCCGGT
GGCTCGAGGCACGATGCCGACGTACACGCTTCGCGATTTGATTCGCTCGCCGCCTCGAGCGCCGGCAGCACCACG
ACGTACCTCAGCCGAGACTCGGAAACTAGCATCGTGTCGCAGACGTCGACGCGGGCCACGACGCCCGACCACGGC
CTCGTGCCGCGCAGCAAGCCGTCCATGTCGGAGCTCAGCAGCTTCTCGCACGTCGACGATGCCGACGACGTCGAG
GCCAGGCTGCTTGAGAGGACGTATGCCCACGAGCTCATGTTCAATAAGGAGGGCCAGGTTACGGGCGGCTCCTTG
CCCGCGCTCGTTGAGCGCCTCACGACGCACGAGTCAACGCCCGATGCCGCCTTCGTCTCAACGTTCTACCTGACC
TTCCGCCTCTTCTGCACGCCCGTCAAGTTGACGGAAGCTCTCATTGACCGCTTCGACTATGTTGGCGAGTCCCCT
CACATGGCGGTACCGGTCCGGCTCAGAGTGTACAACGTCTTTAAAGGCTGGCTCGAGTCCCACTGGAGGGACCGC
ACCGACCGGGAGGCGCTTAAACTCGTCATCCCCTTCGCCGAGCAGAAGCTCGGCGCCGTCCTCTCCTCGGCCGGT
CGCCGTCTGCTCGAGCTGGCCAAGCGGGTTTCGAGCGACAAATCGCTGGTGCCCCGGCTGGTGTCTTCGATGGGA
AAGACAAACACGGCCATCGGGCCGTATGTGCCGGCGGACACACCGGTGCCACATCCGGCCATCTCCAAGAGCCAG
CTGCACGCACTCAGCGCCTTCCGGGCCGGGGGAAACGCGCCGTCGATTGTCGACCTGGAGCCGCTGGAGCTCGCG
CGCCAGTTGACGGTTCGGCAGATGAGCATCTTCTGCTCCATTCTGCCGGAGGAGCTACTCGCGTCGCAGTGGATG
AAGAAGGGCGGCGTGGACGCGCCTCACGTCAAGGCCATGTCGTCGCTGTCGACGGACCTCTCGAACCTGGTGGCC
GAGACGGTGCTTCAGCATCCGGAGATCAAGAAGCGCGCGGCCGTCATCAAGCAGTGGATCAAAATTGCCAACCAC
TGCCACGAGCTGCACAACTACGACGGGCTGATGGCCATCATCTGCAGCCTCAACAGCAGCACCATCAGCCGCCTG
CGCAAGACGTGGGACGCCGTGTCGCCCAAGCGCAAGGAGGTGCTTCGCGCTCTGCAGGACCTGGTCGAGCCGTCG
CAGAACCACAAGGTGCTGCGGACGAGGCTCCACGATCACGTCCCGCCCTGTCTGCCCTTCCTCGGCATGTATCTG
ACGGACCTGACGTTTGTCGACATCGGCAACCCGGCGACCAAGCACATGTCGCTCGGCGGAGAGTCGGACGACTCC
AGCGCCGGCGGCCTGACGGTTGTCAACTTTGATAAGCACTGCCGTACCGCCAAGATCATTGGCGAGCTGCAGCGC
TTCCAGATCCCCTACCGGCTGCTCGAGGTGCCGGACATGCAGGAGTGGTGGGCGGCGCAGATCCGACGGGTTCGC
GCCGGCGACCAGGGCAAGGTCCAGGTCACGTACTACCGCAAGAGCCTGCTCCTCGAGCCCCGAGAGCCGACTCCG
CGACGGGATCATCACGATCCGGCGGCGCCCGCGACGTCGGGCTCGACGGCCCCATCCCGGCCGGACCTCTTCGGT
TGGATGTCTCGCGACCGGGGCGGCCAGACGCCGACGCCGGCTCAGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail