Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3667
Gene name
Locationscaffold_29:44378..46042
Strand-
Gene length (bp)1664
Transcript length (bp)1497
Coding sequence length (bp)1494
Protein length (aa) 498

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.0E-17 85 428
PF05978 UNC-93 Ion channel regulatory protein UNC-93 8.4E-15 75 424

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URX1|YLX5_SCHPO UNC93-like protein C922.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.05c PE=3 SV=1 24 474 3.0E-142
sp|Q8LG53|UN932_ARATH UNC93-like protein 2 OS=Arabidopsis thaliana GN=At1g18010 PE=2 SV=2 42 465 3.0E-102
sp|Q56WD3|UN931_ARATH UNC93-like protein 1 OS=Arabidopsis thaliana GN=At1g18000 PE=2 SV=2 42 465 3.0E-102
sp|O14237|YEL4_SCHPO Uncharacterized membrane protein C6F6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.04c PE=4 SV=1 43 485 3.0E-50

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 85 102 17
3 107 129 22
4 136 158 22
5 173 192 19
6 205 224 19
7 256 278 22
8 299 321 22
9 326 348 22
10 379 401 22
11 440 462 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3667
MDTDKKAHGLAVDETSSTHGHGPRPRGFIYKSFRVFGRQVWYASPKVQLLMVSLVCFLCPGMYNSLTGLGGGGQV
DATAQDHANVALYSTFAVVSFLSGSFANRLGLRLTLSIGGLGYCIYSASFLSYSHTGNVGFVIFAGAFLGLCAGL
LWTAQGAIMMSYPPENSKGRYISCFWIIFNLGAVIGSLIPLAENINKKAGPVTDGTYIAFIILMLLGAGLSLMLC
DADKVIRDDNTKVILMKNPSWSSELKGLYDTLFQEPWILLLFPMFFASNFFYTYQNNDMNAAHFNTRTRALNNLL
YWLAQIFGAILSGHCLDLHYIRRSLRARLAFGFLATLTFVIWGGGWHWQKQQVARAVAESKDYKGLIDWTDGSRF
AEPMVLYFFYGFYDAIWQTSIYWFMGSLSNSGRKAANLAGFYKSIQSFGASIAYYMDGSKKGYDTIFGVTWGLLA
SSLLFALPVILYKIKDHVSVEDDLKFSDETIDDVIVGSGEKTHTRPEV
Coding >Ophio5|3667
ATGGACACCGACAAGAAGGCTCACGGCCTCGCCGTCGATGAAACCTCGTCCACCCATGGCCATGGCCCCCGCCCC
CGTGGCTTCATCTATAAATCGTTCCGCGTTTTTGGCCGTCAGGTTTGGTACGCCTCGCCCAAAGTTCAGCTCTTG
ATGGTCTCGCTCGTCTGCTTTCTCTGTCCCGGCATGTACAACTCTCTCACCGGCCTCGGAGGTGGTGGTCAGGTA
GACGCCACGGCCCAGGATCATGCAAACGTCGCCCTCTACAGCACCTTTGCCGTCGTCAGCTTCTTATCTGGCTCT
TTCGCCAATCGCCTTGGATTGCGCCTCACCCTGTCCATTGGCGGTCTTGGATACTGCATCTATAGCGCCTCGTTC
CTCTCTTACTCCCATACGGGCAATGTTGGCTTCGTCATCTTCGCCGGCGCTTTTCTCGGCCTATGCGCCGGCTTG
CTCTGGACGGCGCAAGGGGCCATCATGATGTCGTACCCGCCTGAGAACAGCAAGGGCCGCTACATCTCGTGCTTC
TGGATCATCTTCAACCTCGGCGCCGTCATCGGCTCACTCATCCCACTCGCCGAAAACATCAACAAAAAGGCCGGA
CCCGTCACCGACGGCACATACATCGCCTTCATCATTCTCATGCTCCTCGGCGCCGGCCTCTCGCTCATGCTTTGC
GACGCCGACAAGGTCATCCGCGACGACAACACCAAAGTCATCCTGATGAAGAACCCGTCCTGGTCGAGCGAGCTC
AAGGGCCTCTATGACACCCTCTTTCAAGAGCCCTGGATCCTCCTCCTCTTCCCCATGTTCTTCGCCTCCAACTTC
TTCTACACCTACCAGAACAATGACATGAACGCGGCTCACTTCAATACCCGCACCCGCGCTCTCAATAATCTGCTC
TACTGGCTCGCCCAGATCTTCGGCGCCATTCTCTCCGGCCACTGCCTTGACTTGCACTACATCCGCCGCAGCCTG
CGCGCCAGGCTCGCTTTTGGCTTCCTCGCCACCCTCACCTTCGTCATCTGGGGGGGCGGATGGCATTGGCAGAAG
CAGCAAGTCGCCCGCGCCGTCGCCGAGAGCAAGGACTACAAAGGCCTCATCGACTGGACCGACGGAAGCCGCTTC
GCCGAGCCCATGGTTCTCTACTTCTTCTACGGCTTCTACGACGCCATCTGGCAGACCTCCATCTACTGGTTCATG
GGATCTCTGTCCAACTCCGGTCGCAAGGCCGCCAATCTCGCAGGCTTCTACAAGTCGATTCAGTCCTTCGGAGCC
AGCATCGCGTACTACATGGATGGCAGCAAAAAGGGGTACGACACCATCTTTGGAGTGACCTGGGGTTTGCTGGCG
AGCTCCTTATTATTTGCCCTTCCTGTCATCCTGTACAAGATCAAGGACCACGTGTCGGTGGAAGATGACCTCAAG
TTCAGCGACGAGACCATTGACGACGTCATCGTTGGGTCTGGGGAGAAGACCCACACGCGCCCGGAGGTC
Transcript >Ophio5|3667
ATGGACACCGACAAGAAGGCTCACGGCCTCGCCGTCGATGAAACCTCGTCCACCCATGGCCATGGCCCCCGCCCC
CGTGGCTTCATCTATAAATCGTTCCGCGTTTTTGGCCGTCAGGTTTGGTACGCCTCGCCCAAAGTTCAGCTCTTG
ATGGTCTCGCTCGTCTGCTTTCTCTGTCCCGGCATGTACAACTCTCTCACCGGCCTCGGAGGTGGTGGTCAGGTA
GACGCCACGGCCCAGGATCATGCAAACGTCGCCCTCTACAGCACCTTTGCCGTCGTCAGCTTCTTATCTGGCTCT
TTCGCCAATCGCCTTGGATTGCGCCTCACCCTGTCCATTGGCGGTCTTGGATACTGCATCTATAGCGCCTCGTTC
CTCTCTTACTCCCATACGGGCAATGTTGGCTTCGTCATCTTCGCCGGCGCTTTTCTCGGCCTATGCGCCGGCTTG
CTCTGGACGGCGCAAGGGGCCATCATGATGTCGTACCCGCCTGAGAACAGCAAGGGCCGCTACATCTCGTGCTTC
TGGATCATCTTCAACCTCGGCGCCGTCATCGGCTCACTCATCCCACTCGCCGAAAACATCAACAAAAAGGCCGGA
CCCGTCACCGACGGCACATACATCGCCTTCATCATTCTCATGCTCCTCGGCGCCGGCCTCTCGCTCATGCTTTGC
GACGCCGACAAGGTCATCCGCGACGACAACACCAAAGTCATCCTGATGAAGAACCCGTCCTGGTCGAGCGAGCTC
AAGGGCCTCTATGACACCCTCTTTCAAGAGCCCTGGATCCTCCTCCTCTTCCCCATGTTCTTCGCCTCCAACTTC
TTCTACACCTACCAGAACAATGACATGAACGCGGCTCACTTCAATACCCGCACCCGCGCTCTCAATAATCTGCTC
TACTGGCTCGCCCAGATCTTCGGCGCCATTCTCTCCGGCCACTGCCTTGACTTGCACTACATCCGCCGCAGCCTG
CGCGCCAGGCTCGCTTTTGGCTTCCTCGCCACCCTCACCTTCGTCATCTGGGGGGGCGGATGGCATTGGCAGAAG
CAGCAAGTCGCCCGCGCCGTCGCCGAGAGCAAGGACTACAAAGGCCTCATCGACTGGACCGACGGAAGCCGCTTC
GCCGAGCCCATGGTTCTCTACTTCTTCTACGGCTTCTACGACGCCATCTGGCAGACCTCCATCTACTGGTTCATG
GGATCTCTGTCCAACTCCGGTCGCAAGGCCGCCAATCTCGCAGGCTTCTACAAGTCGATTCAGTCCTTCGGAGCC
AGCATCGCGTACTACATGGATGGCAGCAAAAAGGGGTACGACACCATCTTTGGAGTGACCTGGGGTTTGCTGGCG
AGCTCCTTATTATTTGCCCTTCCTGTCATCCTGTACAAGATCAAGGACCACGTGTCGGTGGAAGATGACCTCAAG
TTCAGCGACGAGACCATTGACGACGTCATCGTTGGGTCTGGGGAGAAGACCCACACGCGCCCGGAGGTCTGA
Gene >Ophio5|3667
ATGGACACCGACAAGAAGGCTCACGGCCTCGCCGTCGATGAAACCTCGTCCACCCATGGCCATGGCCCCCGCCCC
CGTGGCTTCATCTATAAATCGTTCCGCGTTTTTGGCCGTCAGGTTTGGTACGCCTCGCCCAAAGTTCAGCTCTTG
ATGGTCTCGCTCGTCTGCTTTCTCTGTCCCGGCATGTACAACTCTCTCACCGGCCTCGGAGGTGGTGGTCAGGTA
GACGCCACGGCCCAGGATCATGCAAACGTCGCCCTCTACAGCACCTTTGCCGTCGTCAGCTTCTTATCTGGCTCT
TTCGCCAATCGCCTTGGATTGCGCCTCACCCTGTCCATTGGCGGTCTTGGATACTGCATCTATAGCGCCTCGTTC
CTCTCTTACTCCCATACGGGCAATGTTGGCTTCGTCATCTTCGCCGGCGCTTTTCTCGGCCTATGCGCCGGCTTG
CTCTGGACGGCGCAAGGGGCCATCATGATGTCGTACCCGCCTGAGAACAGCAAGGGCCGCTACATCTCGTGCTTC
TGGATCATCTTCAACCTCGGCGCCGTCATCGGCTCACTCGTCCGTTCGGCCTCGATCCCCTTATTCATCTTCCCG
CCCGCTCTAACGTCGTCCAGATCCCACTCGCCGAAAACATCAACAAAAAGGCCGGACCCGTCACCGACGGCACAT
ACATCGCCTTCATCATTCTCATGCTCCTCGGCGCCGGCCTCTCGCTCATGCTTTGCGACGCCGACAAGGTCATCC
GCGACGACAACACCAAAGTCATCCTGATGAAGAACCCGTCCTGGTCGAGCGAGCTCAAGGGCCTCTATGACACCC
TCTTTCAAGAGCCCTGGATCCTCCTCCTCTTCCCCATGTTCTTCGCCTCCAACTTCTTCTACACCTACCAGAACA
ATGACATGAACGCGGCTCACTTCAATACCCGCACCCGCGCTCTCAATAATCTGCTCTACTGGCTCGCCCAGATCT
TCGGCGCCATTCTCTCCGGCCACTGCCTTGACTTGCACTACATCCGCCGCAGCCTGCGCGCCAGGCTCGCTTTTG
GCTTCCTCGCCACCCTCACCTTCGTCATCTGGGGGGGCGGATGGCATTGGCAGAAGCAGCAAGTCGCCCGCGCCG
TCGCCGAGAGCAAGGACTACAAAGGCCTCATCGACTGGACCGACGGAAGCCGCTTCGCCGAGCCCATGGTTCTCT
ACTTCTTCTACGGCTTCTACGACGCCATCTGGCAGACCTCCATCTACTGGTATGTCTTGCCCTGCTCAAGCGATT
GATATAGGATGTTGACGGAAGTACAGGTTCATGGGATCTCTGTCCAACTCCGGTCGCAAGGCCGCCAATCTCGCA
GGTCAGTCATTGTCTGCCACGAGCAAGACCCTCATGCCGCTGACATTTTCGAACCCGCAGGCTTCTACAAGTCGA
TTCAGTCCTTCGGAGCCAGCATCGCGTACTACATGGATGGCAGCAAAAAGGGGTACGACACCATCTTTGGAGTGA
CCTGGGGTTTGCTGGCGAGCTCCTTATTATTTGCCCTTCCTGTCATCCTGTACAAGATCAAGGACCACGTGTCGG
TGGAAGATGACCTCAAGTTCAGCGACGAGACCATTGACGACGTCATCGTTGGGTCTGGGGAGAAGACCCACACGC
GCCCGGAGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail