Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3666
Gene name
Locationscaffold_29:43352..43832
Strand+
Gene length (bp)480
Transcript length (bp)423
Coding sequence length (bp)420
Protein length (aa) 140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10937 S36_mt Ribosomal protein S36, mitochondrial 2.4E-41 17 136

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006103 2-oxoglutarate metabolic process Yes
GO:0009353 mitochondrial oxoglutarate dehydrogenase complex Yes
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0005947 mitochondrial alpha-ketoglutarate dehydrogenase complex No
GO:0006082 organic acid metabolic process No
GO:0045240 dihydrolipoyl dehydrogenase complex No
GO:0030062 mitochondrial tricarboxylic acid cycle enzyme complex No
GO:0098798 mitochondrial protein-containing complex No
GO:0032991 protein-containing complex No
GO:0043436 oxoacid metabolic process No
GO:1902494 catalytic complex No
GO:0008152 metabolic process No
GO:0045239 tricarboxylic acid cycle enzyme complex No
GO:1990234 transferase complex No
GO:1990204 oxidoreductase complex No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0043648 dicarboxylic acid metabolic process No
GO:0045252 oxoglutarate dehydrogenase complex No
GO:0005575 cellular_component No
GO:0019752 carboxylic acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3666
MFATRVLRQAAVHADRTPMIKFLGPRSIPSSVDHTPKPHPASPTGTLPESFSGYGNSSSVSRHNSFSSYRDHAQQ
HGPLQKSIRGFEAGIGGSSGSQLGSIEPAKGVHFDLSELPSRFRRVPFDMAEIEAIESGGAALCR
Coding >Ophio5|3666
ATGTTCGCAACTCGAGTCCTTCGGCAGGCCGCCGTCCACGCCGACCGCACACCCATGATCAAGTTTCTCGGCCCC
CGCTCCATTCCTTCCTCCGTCGACCACACGCCTAAACCTCATCCCGCCTCCCCTACCGGAACGCTCCCGGAGTCC
TTCTCCGGCTACGGCAACAGCTCTTCCGTCTCGCGCCATAACTCTTTCAGTTCGTACCGCGACCACGCCCAGCAA
CACGGCCCCTTGCAAAAGTCCATCCGTGGCTTCGAAGCCGGCATTGGCGGGTCTTCCGGCTCCCAATTGGGCTCC
ATCGAACCTGCAAAGGGCGTCCACTTCGACCTCTCCGAACTGCCGTCCCGCTTCCGTCGCGTTCCCTTCGATATG
GCTGAGATTGAGGCCATTGAATCTGGCGGCGCTGCCCTGTGCCGC
Transcript >Ophio5|3666
ATGTTCGCAACTCGAGTCCTTCGGCAGGCCGCCGTCCACGCCGACCGCACACCCATGATCAAGTTTCTCGGCCCC
CGCTCCATTCCTTCCTCCGTCGACCACACGCCTAAACCTCATCCCGCCTCCCCTACCGGAACGCTCCCGGAGTCC
TTCTCCGGCTACGGCAACAGCTCTTCCGTCTCGCGCCATAACTCTTTCAGTTCGTACCGCGACCACGCCCAGCAA
CACGGCCCCTTGCAAAAGTCCATCCGTGGCTTCGAAGCCGGCATTGGCGGGTCTTCCGGCTCCCAATTGGGCTCC
ATCGAACCTGCAAAGGGCGTCCACTTCGACCTCTCCGAACTGCCGTCCCGCTTCCGTCGCGTTCCCTTCGATATG
GCTGAGATTGAGGCCATTGAATCTGGCGGCGCTGCCCTGTGCCGCTAG
Gene >Ophio5|3666
ATGTTCGCAACTCGAGTCCTTCGGCAGGCCGCCGTCCACGCCGACCGCACACCCATGATCAAGTTTCTCGGCCCC
CGCTCCATTCCTTGTGAGCTGTCCTTTTCATTTTCTTTGTCCCTTCCTCTTTACTGACCGATTCGAGCAGCCTCC
GTCGACCACACGCCTAAACCTCATCCCGCCTCCCCTACCGGAACGCTCCCGGAGTCCTTCTCCGGCTACGGCAAC
AGCTCTTCCGTCTCGCGCCATAACTCTTTCAGTTCGTACCGCGACCACGCCCAGCAACACGGCCCCTTGCAAAAG
TCCATCCGTGGCTTCGAAGCCGGCATTGGCGGGTCTTCCGGCTCCCAATTGGGCTCCATCGAACCTGCAAAGGGC
GTCCACTTCGACCTCTCCGAACTGCCGTCCCGCTTCCGTCGCGTTCCCTTCGATATGGCTGAGATTGAGGCCATT
GAATCTGGCGGCGCTGCCCTGTGCCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail