Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3665
Gene name
Locationscaffold_29:40922..42373
Strand+
Gene length (bp)1451
Transcript length (bp)1386
Coding sequence length (bp)1383
Protein length (aa) 461

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 81.86 44.43 119.30
CcL In ants, during behavior modification 242.82 104.30 381.32
CcD In ants, recently dead 142.46 74.00 210.91

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.014568 yes
CcL CcD 0.040344 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3665
MGSTWASKSVDEPPPIDCPSPRHPGLKALLAFVTQRIRRAGARSLVLFAALFLVVPALVRLTPASWHRHWTWSQA
TSSNLRIVVFGSQDLLGSASGRPTWTERLCIELGCSSHFSLVPPAGSSHGLTSNGIYADEIHALEERMKKTDLAK
SPALNYSFVAEQYPVSAQTPDLEAQLQRFLSRQPAAVAPHSTLWVFTFGTWDIWNLAALPRESSEHAIDALVSHL
FSQVEVLYGDSLHRRSIAYSDFWAGVAKSDVERLADPGAQGRVDEREQEGFRIVIPDLLDVTLTPGWQTRPEPPA
PHSKAEQMRNAAFLTKRWNSKVGEELGRWVAKGRARPEAMELSDQPEGKYPAAILQTGKGGLMDGPYPRRAGMRS
TPAATILDAMTEQEVQRTGLSKEHAAIGMLDVSTPCVEGDETCSTPDAHLFHDAFTVGQRAAEGAVRVTAERISE
ELILSPRGRAL
Coding >Ophio5|3665
ATGGGCTCCACGTGGGCCTCCAAGTCGGTCGATGAACCGCCACCCATCGACTGTCCTTCTCCTCGGCACCCCGGG
CTCAAGGCGCTATTGGCTTTTGTCACGCAGCGCATCAGACGAGCGGGCGCGCGCTCCCTCGTGCTATTCGCGGCT
CTGTTTCTCGTCGTCCCAGCCCTCGTGCGCCTGACACCCGCATCCTGGCATCGCCATTGGACTTGGTCCCAGGCT
ACGAGCAGCAACTTGAGAATTGTCGTCTTCGGCTCCCAGGACCTACTGGGCAGCGCCTCCGGTCGGCCGACGTGG
ACGGAACGGCTCTGCATCGAGCTCGGCTGCTCCTCACATTTCTCCCTCGTCCCTCCAGCAGGCTCGAGTCACGGA
CTTACATCCAATGGCATCTACGCCGATGAGATCCATGCGCTCGAGGAACGGATGAAAAAGACGGATCTGGCCAAG
TCGCCGGCATTAAACTACTCCTTCGTCGCCGAACAATACCCCGTTTCGGCGCAGACGCCGGACCTTGAGGCGCAG
TTGCAGCGATTCCTTTCTCGCCAACCAGCTGCCGTCGCTCCACACAGCACCCTCTGGGTCTTTACCTTTGGAACC
TGGGACATTTGGAATCTGGCGGCTCTGCCTCGGGAATCTAGCGAGCACGCCATCGACGCCCTGGTGTCGCATCTA
TTCTCCCAGGTCGAGGTGCTGTATGGCGACTCACTCCATCGCAGATCGATTGCCTACTCGGACTTTTGGGCTGGC
GTGGCCAAGTCAGACGTCGAAAGGCTCGCAGACCCAGGCGCGCAAGGGAGGGTAGATGAGCGCGAGCAGGAAGGC
TTCCGGATCGTCATCCCAGACCTGCTCGACGTCACGCTCACGCCCGGGTGGCAGACGCGGCCGGAACCACCGGCA
CCGCACTCCAAGGCGGAGCAGATGCGCAACGCTGCCTTCCTGACCAAGCGATGGAACTCCAAGGTGGGAGAAGAG
CTGGGACGCTGGGTAGCCAAGGGAAGGGCGAGGCCGGAGGCGATGGAGCTGAGTGATCAACCCGAGGGCAAATAC
CCCGCAGCTATCTTGCAGACCGGCAAGGGGGGCCTCATGGACGGGCCGTATCCGCGCAGGGCCGGGATGCGGTCG
ACGCCGGCGGCCACGATCCTTGACGCCATGACAGAGCAGGAGGTGCAACGGACGGGTCTGAGCAAAGAGCACGCA
GCGATAGGCATGTTGGATGTGTCGACACCTTGCGTGGAGGGCGATGAGACATGCTCCACGCCGGACGCCCACCTG
TTTCACGATGCCTTTACCGTCGGCCAACGGGCGGCGGAGGGGGCCGTCCGGGTGACGGCGGAGAGAATCTCGGAG
GAGCTCATACTCTCACCGCGTGGAAGGGCATTG
Transcript >Ophio5|3665
ATGGGCTCCACGTGGGCCTCCAAGTCGGTCGATGAACCGCCACCCATCGACTGTCCTTCTCCTCGGCACCCCGGG
CTCAAGGCGCTATTGGCTTTTGTCACGCAGCGCATCAGACGAGCGGGCGCGCGCTCCCTCGTGCTATTCGCGGCT
CTGTTTCTCGTCGTCCCAGCCCTCGTGCGCCTGACACCCGCATCCTGGCATCGCCATTGGACTTGGTCCCAGGCT
ACGAGCAGCAACTTGAGAATTGTCGTCTTCGGCTCCCAGGACCTACTGGGCAGCGCCTCCGGTCGGCCGACGTGG
ACGGAACGGCTCTGCATCGAGCTCGGCTGCTCCTCACATTTCTCCCTCGTCCCTCCAGCAGGCTCGAGTCACGGA
CTTACATCCAATGGCATCTACGCCGATGAGATCCATGCGCTCGAGGAACGGATGAAAAAGACGGATCTGGCCAAG
TCGCCGGCATTAAACTACTCCTTCGTCGCCGAACAATACCCCGTTTCGGCGCAGACGCCGGACCTTGAGGCGCAG
TTGCAGCGATTCCTTTCTCGCCAACCAGCTGCCGTCGCTCCACACAGCACCCTCTGGGTCTTTACCTTTGGAACC
TGGGACATTTGGAATCTGGCGGCTCTGCCTCGGGAATCTAGCGAGCACGCCATCGACGCCCTGGTGTCGCATCTA
TTCTCCCAGGTCGAGGTGCTGTATGGCGACTCACTCCATCGCAGATCGATTGCCTACTCGGACTTTTGGGCTGGC
GTGGCCAAGTCAGACGTCGAAAGGCTCGCAGACCCAGGCGCGCAAGGGAGGGTAGATGAGCGCGAGCAGGAAGGC
TTCCGGATCGTCATCCCAGACCTGCTCGACGTCACGCTCACGCCCGGGTGGCAGACGCGGCCGGAACCACCGGCA
CCGCACTCCAAGGCGGAGCAGATGCGCAACGCTGCCTTCCTGACCAAGCGATGGAACTCCAAGGTGGGAGAAGAG
CTGGGACGCTGGGTAGCCAAGGGAAGGGCGAGGCCGGAGGCGATGGAGCTGAGTGATCAACCCGAGGGCAAATAC
CCCGCAGCTATCTTGCAGACCGGCAAGGGGGGCCTCATGGACGGGCCGTATCCGCGCAGGGCCGGGATGCGGTCG
ACGCCGGCGGCCACGATCCTTGACGCCATGACAGAGCAGGAGGTGCAACGGACGGGTCTGAGCAAAGAGCACGCA
GCGATAGGCATGTTGGATGTGTCGACACCTTGCGTGGAGGGCGATGAGACATGCTCCACGCCGGACGCCCACCTG
TTTCACGATGCCTTTACCGTCGGCCAACGGGCGGCGGAGGGGGCCGTCCGGGTGACGGCGGAGAGAATCTCGGAG
GAGCTCATACTCTCACCGCGTGGAAGGGCATTGTAG
Gene >Ophio5|3665
ATGGGCTCCACGTGGGCCTCCAAGTCGGTCGATGAACCGCCACCCATCGACTGTCCTTCTCCTCGGCACCCCGGG
CTCAAGGCGCTATTGGCTTTTGTCACGCAGCGCATCAGACGAGCGGGCGCGCGCTCCCTCGTGCTATTCGCGGCT
CTGTTTCTCGTCGTCCCAGCCCTCGTGCGCCTGACACCCGCATCCTGGCATCGCCATTGGACTTGGTCCCAGGCT
ACGAGCAGCAACTTGAGAATTGTCGTCTTCGGCTCCCAGGACCTACTGGGCAGCGCCTCCGGTCGGCCGACGTGG
ACGGAACGGCTCTGCATCGAGGTAAGCGATGATTGGCGAGGAGTACGAATCCTTGGGGGGCTCGGCAGCTCACAG
TCTCTCAAAAGCTCGGCTGCTCCTCACATTTCTCCCTCGTCCCTCCAGCAGGCTCGAGTCACGGACTTACATCCA
ATGGCATCTACGCCGATGAGATCCATGCGCTCGAGGAACGGATGAAAAAGACGGATCTGGCCAAGTCGCCGGCAT
TAAACTACTCCTTCGTCGCCGAACAATACCCCGTTTCGGCGCAGACGCCGGACCTTGAGGCGCAGTTGCAGCGAT
TCCTTTCTCGCCAACCAGCTGCCGTCGCTCCACACAGCACCCTCTGGGTCTTTACCTTTGGAACCTGGGACATTT
GGAATCTGGCGGCTCTGCCTCGGGAATCTAGCGAGCACGCCATCGACGCCCTGGTGTCGCATCTATTCTCCCAGG
TCGAGGTGCTGTATGGCGACTCACTCCATCGCAGATCGATTGCCTACTCGGACTTTTGGGCTGGCGTGGCCAAGT
CAGACGTCGAAAGGCTCGCAGACCCAGGCGCGCAAGGGAGGGTAGATGAGCGCGAGCAGGAAGGCTTCCGGATCG
TCATCCCAGACCTGCTCGACGTCACGCTCACGCCCGGGTGGCAGACGCGGCCGGAACCACCGGCACCGCACTCCA
AGGCGGAGCAGATGCGCAACGCTGCCTTCCTGACCAAGCGATGGAACTCCAAGGTGGGAGAAGAGCTGGGACGCT
GGGTAGCCAAGGGAAGGGCGAGGCCGGAGGCGATGGAGCTGAGTGATCAACCCGAGGGCAAATACCCCGCAGCTA
TCTTGCAGACCGGCAAGGGGGGCCTCATGGACGGGCCGTATCCGCGCAGGGCCGGGATGCGGTCGACGCCGGCGG
CCACGATCCTTGACGCCATGACAGAGCAGGAGGTGCAACGGACGGGTCTGAGCAAAGAGCACGCAGCGATAGGCA
TGTTGGATGTGTCGACACCTTGCGTGGAGGGCGATGAGACATGCTCCACGCCGGACGCCCACCTGTTTCACGATG
CCTTTACCGTCGGCCAACGGGCGGCGGAGGGGGCCGTCCGGGTGACGGCGGAGAGAATCTCGGAGGAGCTCATAC
TCTCACCGCGTGGAAGGGCATTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail