Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3663
Gene name
Locationscaffold_29:33580..34776
Strand-
Gene length (bp)1196
Transcript length (bp)1146
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.8E-12 3 339
PF00083 Sugar_tr Sugar (and other) transporter 2.9E-08 2 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 6 380 1.0E-80
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 7 379 8.0E-12
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 16 342 9.0E-10
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 24 378 7.0E-08
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 189 337 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 6 380 1.0E-80
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 7 379 8.0E-12
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 16 342 9.0E-10
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 24 378 7.0E-08
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 189 337 4.0E-07
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 24 378 6.0E-07
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 24 378 9.0E-07
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 24 378 1.0E-06
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 194 378 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 55 75 20
3 95 117 22
4 198 220 22
5 265 284 19
6 291 313 22
7 351 373 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3663
MCAACCIVAGAMPNWPSLGLFIALLGFGGGGNLILDSVVFLEYLPSSKQWLLTALACWWGLGQAVASSIGWIFMV
PPQWNCTDSDGCTRDNNWGWRFTLFAGGGLVLTLSLLRITVIRLRETPKYQLSVGQEAELVETFHFLALKYDRSC
SLTLEKLEACGTIRSVGRNGRFSFVSEALAHVGGLFSTRKLAMSTTMLWFSWSLIGLAYALFFVFLPTYLKNSGV
TFERPEAERWRNLVITDLSGVPGPVIAGLLCNLRPLGRRYTMTIGALCTAAFFFAYPTVKTATQDLILACFIACF
IHVYYGTLYAYTPEVLPSAHRATGNGIAVACNRVMGIVSAVVASGANTSTPVPLYICGGLLITAAVVATMFPLEP
CSRRSS
Coding >Ophio5|3663
ATGTGCGCCGCCTGCTGCATCGTCGCCGGTGCTATGCCCAACTGGCCTTCACTCGGCCTCTTCATCGCTCTCCTC
GGCTTCGGCGGAGGCGGCAACCTCATCCTCGACTCCGTCGTCTTCCTCGAGTACCTGCCCAGCTCTAAGCAGTGG
CTTCTGACGGCGCTCGCCTGCTGGTGGGGGCTCGGCCAGGCCGTTGCCAGCTCCATCGGCTGGATCTTCATGGTG
CCCCCTCAATGGAACTGCACCGACAGTGATGGTTGCACCCGGGACAACAATTGGGGTTGGCGCTTCACGCTCTTC
GCAGGCGGTGGCCTCGTCCTTACCCTGTCGCTGCTCCGCATCACGGTCATTCGTCTGCGCGAGACGCCCAAGTAT
CAGTTAAGCGTGGGCCAGGAGGCCGAGCTCGTAGAGACGTTCCACTTCCTTGCCCTCAAATACGATCGTTCTTGC
TCATTGACGTTGGAAAAGCTTGAGGCTTGCGGCACCATCCGGTCCGTCGGCCGAAACGGTCGCTTCTCCTTTGTC
TCCGAGGCGCTGGCTCATGTTGGCGGTCTCTTTTCCACCAGGAAGCTGGCCATGTCGACCACTATGCTCTGGTTC
TCGTGGTCACTAATCGGCCTGGCCTATGCTCTCTTCTTCGTCTTCTTGCCGACCTACTTGAAGAACAGCGGCGTA
ACGTTCGAGCGCCCGGAGGCCGAGAGGTGGCGCAACCTGGTCATCACCGACTTGAGTGGCGTGCCGGGTCCCGTC
ATCGCCGGCCTCCTCTGCAACCTGAGGCCGCTGGGCCGCAGATACACCATGACCATCGGCGCCCTATGTACAGCC
GCCTTTTTCTTCGCGTACCCGACGGTCAAGACGGCGACGCAGGATCTGATCTTGGCCTGCTTCATCGCCTGCTTC
ATACACGTCTACTACGGCACGCTCTACGCCTACACGCCCGAGGTGCTCCCCAGCGCCCACCGAGCGACGGGCAAC
GGCATCGCCGTGGCTTGCAACCGCGTCATGGGCATCGTGTCGGCCGTCGTTGCCTCTGGTGCCAATACGTCGACC
CCGGTGCCCTTGTACATCTGCGGAGGGTTGCTCATCACGGCCGCCGTCGTGGCAACTATGTTTCCCCTAGAGCCT
TGCAGCCGGAGGAGCTCG
Transcript >Ophio5|3663
ATGTGCGCCGCCTGCTGCATCGTCGCCGGTGCTATGCCCAACTGGCCTTCACTCGGCCTCTTCATCGCTCTCCTC
GGCTTCGGCGGAGGCGGCAACCTCATCCTCGACTCCGTCGTCTTCCTCGAGTACCTGCCCAGCTCTAAGCAGTGG
CTTCTGACGGCGCTCGCCTGCTGGTGGGGGCTCGGCCAGGCCGTTGCCAGCTCCATCGGCTGGATCTTCATGGTG
CCCCCTCAATGGAACTGCACCGACAGTGATGGTTGCACCCGGGACAACAATTGGGGTTGGCGCTTCACGCTCTTC
GCAGGCGGTGGCCTCGTCCTTACCCTGTCGCTGCTCCGCATCACGGTCATTCGTCTGCGCGAGACGCCCAAGTAT
CAGTTAAGCGTGGGCCAGGAGGCCGAGCTCGTAGAGACGTTCCACTTCCTTGCCCTCAAATACGATCGTTCTTGC
TCATTGACGTTGGAAAAGCTTGAGGCTTGCGGCACCATCCGGTCCGTCGGCCGAAACGGTCGCTTCTCCTTTGTC
TCCGAGGCGCTGGCTCATGTTGGCGGTCTCTTTTCCACCAGGAAGCTGGCCATGTCGACCACTATGCTCTGGTTC
TCGTGGTCACTAATCGGCCTGGCCTATGCTCTCTTCTTCGTCTTCTTGCCGACCTACTTGAAGAACAGCGGCGTA
ACGTTCGAGCGCCCGGAGGCCGAGAGGTGGCGCAACCTGGTCATCACCGACTTGAGTGGCGTGCCGGGTCCCGTC
ATCGCCGGCCTCCTCTGCAACCTGAGGCCGCTGGGCCGCAGATACACCATGACCATCGGCGCCCTATGTACAGCC
GCCTTTTTCTTCGCGTACCCGACGGTCAAGACGGCGACGCAGGATCTGATCTTGGCCTGCTTCATCGCCTGCTTC
ATACACGTCTACTACGGCACGCTCTACGCCTACACGCCCGAGGTGCTCCCCAGCGCCCACCGAGCGACGGGCAAC
GGCATCGCCGTGGCTTGCAACCGCGTCATGGGCATCGTGTCGGCCGTCGTTGCCTCTGGTGCCAATACGTCGACC
CCGGTGCCCTTGTACATCTGCGGAGGGTTGCTCATCACGGCCGCCGTCGTGGCAACTATGTTTCCCCTAGAGCCT
TGCAGCCGGAGGAGCTCGTGA
Gene >Ophio5|3663
ATGTGCGCCGCCTGCTGCATCGTCGCCGGTGCTATGCCCAACTGGCCTTCACTCGGCCTCTTCATCGCTCTCCTC
GGCTTCGGCGGAGGCGGCAACCTCATCCTCGACTCCGTCGTCTTCCTCGAGTACCTGCCCAGCTCTAAGCAGTGG
CTTCTGACGGCGCTCGCCTGCTGGTGGGGGCTCGGCCAGGCCGTTGCCAGCTCCATCGGCTGGATCTTCATGGTG
CCCCCTCAATGGAACTGCACCGACAGTGATGGTTGCACCCGGGACAACAATTGGGGTTGGCGCTTCACGCTCTTC
GCAGGCGGTGGCCTCGTCCTTACCCTGTCGCTGCTCCGCATCACGGTCATTCGTCTGCGCGAGACGCCCAAGTAT
CAGTTAAGCGTGGGCCAGGAGGCCGAGCTCGTAGAGACGTTCCACTTCCTTGCCCTCAAATACGATCGTTCTTGC
TCATTGACGTTGGAAAAGCTTGAGGCTTGCGGCACCATCCGGTCCGTCGGCCGAAACGGTCGCTTCTCCTTTGTC
TCCGAGGCGCTGGCTCATGTTGGCGGTCTCTTTTCCACCAGGAAGCTGGCCATGTCGACCACTATGCTCTGGTTC
TCGTGGTCACTAATCGGCCTGGCCTATGCTCTCTTCTTCGTCTTCTTGCCGTGTGTCCCCCGTCTCCCTGCAAAA
TGTTGATCGTCTGACATCGAATCAGGACCTACTTGAAGAACAGCGGCGTAACGTTCGAGCGCCCGGAGGCCGAGA
GGTGGCGCAACCTGGTCATCACCGACTTGAGTGGCGTGCCGGGTCCCGTCATCGCCGGCCTCCTCTGCAACCTGA
GGCCGCTGGGCCGCAGATACACCATGACCATCGGCGCCCTATGTACAGCCGCCTTTTTCTTCGCGTACCCGACGG
TCAAGACGGCGACGCAGGATCTGATCTTGGCCTGCTTCATCGCCTGCTTCATACACGTCTACTACGGCACGCTCT
ACGCCTACACGCCCGAGGTGCTCCCCAGCGCCCACCGAGCGACGGGCAACGGCATCGCCGTGGCTTGCAACCGCG
TCATGGGCATCGTGTCGGCCGTCGTTGCCTCTGGTGCCAATACGTCGACCCCGGTGCCCTTGTACATCTGCGGAG
GGTTGCTCATCACGGCCGCCGTCGTGGCAACTATGTTTCCCCTAGAGCCTTGCAGCCGGAGGAGCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail