Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3661
Gene name
Locationscaffold_29:26384..27887
Strand-
Gene length (bp)1503
Transcript length (bp)1503
Coding sequence length (bp)1500
Protein length (aa) 500

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09350 DJC28_CD DnaJ homologue, subfamily C, member 28, conserved domain 2.4E-19 245 314

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1729 0.1056 0.0599 0.1103 0.9422 0.0292 0.0602 0.0299 0.0568 0.0145

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4860
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1599
Ophiocordyceps australis map64 (Brazil) OphauB2|6729
Ophiocordyceps camponoti-floridani Ophcf2|01833
Ophiocordyceps kimflemingae Ophio5|3661 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10984

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3661
MMASAVGLTSLRLCFRLIRRNPAAAGISYRAGVVESPTPDRSAPKDDAAPEQQRRPLPASSEPGPMARRLEEATE
EAIVSGGTAGRRAVEEAGFSEELKQRLLEKVTDAKFREEHKAAFVEAGLTSAAGEGTRHMATGQPWTGSETVEDA
VLRMLDDAKRPLKPELRGKFEAPAGARPLKRRRVEKAGQRAASARDQAALYTELGIGSSKGLSEAEREDMKREFR
ERFQPAARSIPVSVSGLAALANERIEDAIARGQFKDLPRGKAVEADPQAASPFIDTTEYLLNRIIKRQEIVPPWI
EKQQELGRAARVFRERLRNDWKRHAARMMTARGGSLKEQMRRAEEYAAAERKYVAQNKGSDENMSAPASDDPVGA
EAHPFRDADWERVESAYMKLSIEKLNDLTRSYNLMAPDVARKPYWALRRELDACFAEVAPLLADEIRQRAGARAA
PLPGRPVERRGEGFVEQWRGRDDVRIHVEAEEKAYGLREWWKDVWRRWTG
Coding >Ophio5|3661
ATGATGGCTTCTGCGGTTGGCCTGACGTCGCTCCGCCTCTGCTTCAGGCTCATCAGAAGAAACCCAGCCGCGGCT
GGGATATCGTACCGAGCTGGCGTGGTGGAGAGCCCGACGCCCGACCGGTCTGCACCCAAGGATGACGCAGCCCCC
GAACAGCAGCGTCGACCATTGCCAGCGTCATCGGAGCCGGGGCCGATGGCGCGACGGCTGGAGGAGGCGACGGAG
GAGGCGATTGTGAGCGGCGGCACTGCGGGCAGACGCGCCGTCGAAGAAGCCGGCTTCTCGGAGGAGCTCAAGCAG
AGACTTCTGGAGAAGGTGACCGACGCCAAGTTCAGGGAGGAGCACAAGGCGGCCTTCGTCGAGGCAGGGCTCACG
TCGGCGGCGGGCGAGGGCACGAGGCACATGGCTACTGGGCAGCCCTGGACCGGGTCTGAGACGGTCGAGGACGCG
GTTCTCAGGATGTTGGACGACGCGAAGCGGCCCTTGAAGCCCGAATTGCGTGGCAAATTCGAAGCGCCAGCAGGA
GCGAGGCCTCTCAAGAGGCGTCGAGTCGAGAAGGCTGGACAACGAGCGGCAAGCGCGCGAGACCAAGCGGCCTTG
TATACAGAATTGGGTATCGGGTCCTCCAAGGGATTGAGCGAGGCTGAGAGAGAGGATATGAAGAGGGAGTTTCGG
GAGAGGTTCCAGCCCGCAGCGCGGTCGATTCCAGTCTCCGTCTCAGGGCTGGCGGCTCTGGCCAACGAGAGGATC
GAGGACGCCATCGCAAGAGGGCAGTTCAAGGACCTGCCGCGAGGCAAGGCGGTGGAGGCGGACCCGCAGGCGGCG
AGCCCCTTTATCGACACAACCGAGTACCTCTTGAACAGAATAATCAAGCGACAGGAAATTGTGCCACCGTGGATT
GAGAAGCAGCAGGAGCTCGGCAGGGCGGCGCGCGTCTTCCGCGAACGGCTGCGAAACGACTGGAAGCGTCACGCG
GCGAGGATGATGACCGCCAGGGGGGGCTCGCTGAAAGAACAGATGAGGAGGGCGGAAGAGTACGCGGCGGCGGAG
AGAAAGTACGTTGCGCAAAACAAAGGCTCGGACGAGAACATGTCTGCGCCGGCGTCGGACGACCCGGTCGGTGCA
GAGGCGCATCCCTTCCGCGACGCAGACTGGGAGCGGGTCGAGTCCGCGTACATGAAGCTGTCGATCGAGAAGCTC
AACGACCTGACGAGGAGCTACAATTTGATGGCACCGGACGTGGCGAGGAAGCCCTACTGGGCACTGAGGAGGGAG
CTGGACGCGTGCTTTGCAGAAGTGGCGCCGCTACTGGCTGACGAGATTAGGCAGAGAGCCGGCGCGAGGGCGGCT
CCGCTTCCTGGCCGGCCGGTTGAGAGACGAGGCGAGGGATTCGTAGAGCAGTGGAGGGGTAGAGACGATGTTAGG
ATCCATGTCGAGGCGGAGGAGAAGGCCTATGGGCTGAGGGAGTGGTGGAAGGACGTGTGGAGGAGGTGGACGGGA
Transcript >Ophio5|3661
ATGATGGCTTCTGCGGTTGGCCTGACGTCGCTCCGCCTCTGCTTCAGGCTCATCAGAAGAAACCCAGCCGCGGCT
GGGATATCGTACCGAGCTGGCGTGGTGGAGAGCCCGACGCCCGACCGGTCTGCACCCAAGGATGACGCAGCCCCC
GAACAGCAGCGTCGACCATTGCCAGCGTCATCGGAGCCGGGGCCGATGGCGCGACGGCTGGAGGAGGCGACGGAG
GAGGCGATTGTGAGCGGCGGCACTGCGGGCAGACGCGCCGTCGAAGAAGCCGGCTTCTCGGAGGAGCTCAAGCAG
AGACTTCTGGAGAAGGTGACCGACGCCAAGTTCAGGGAGGAGCACAAGGCGGCCTTCGTCGAGGCAGGGCTCACG
TCGGCGGCGGGCGAGGGCACGAGGCACATGGCTACTGGGCAGCCCTGGACCGGGTCTGAGACGGTCGAGGACGCG
GTTCTCAGGATGTTGGACGACGCGAAGCGGCCCTTGAAGCCCGAATTGCGTGGCAAATTCGAAGCGCCAGCAGGA
GCGAGGCCTCTCAAGAGGCGTCGAGTCGAGAAGGCTGGACAACGAGCGGCAAGCGCGCGAGACCAAGCGGCCTTG
TATACAGAATTGGGTATCGGGTCCTCCAAGGGATTGAGCGAGGCTGAGAGAGAGGATATGAAGAGGGAGTTTCGG
GAGAGGTTCCAGCCCGCAGCGCGGTCGATTCCAGTCTCCGTCTCAGGGCTGGCGGCTCTGGCCAACGAGAGGATC
GAGGACGCCATCGCAAGAGGGCAGTTCAAGGACCTGCCGCGAGGCAAGGCGGTGGAGGCGGACCCGCAGGCGGCG
AGCCCCTTTATCGACACAACCGAGTACCTCTTGAACAGAATAATCAAGCGACAGGAAATTGTGCCACCGTGGATT
GAGAAGCAGCAGGAGCTCGGCAGGGCGGCGCGCGTCTTCCGCGAACGGCTGCGAAACGACTGGAAGCGTCACGCG
GCGAGGATGATGACCGCCAGGGGGGGCTCGCTGAAAGAACAGATGAGGAGGGCGGAAGAGTACGCGGCGGCGGAG
AGAAAGTACGTTGCGCAAAACAAAGGCTCGGACGAGAACATGTCTGCGCCGGCGTCGGACGACCCGGTCGGTGCA
GAGGCGCATCCCTTCCGCGACGCAGACTGGGAGCGGGTCGAGTCCGCGTACATGAAGCTGTCGATCGAGAAGCTC
AACGACCTGACGAGGAGCTACAATTTGATGGCACCGGACGTGGCGAGGAAGCCCTACTGGGCACTGAGGAGGGAG
CTGGACGCGTGCTTTGCAGAAGTGGCGCCGCTACTGGCTGACGAGATTAGGCAGAGAGCCGGCGCGAGGGCGGCT
CCGCTTCCTGGCCGGCCGGTTGAGAGACGAGGCGAGGGATTCGTAGAGCAGTGGAGGGGTAGAGACGATGTTAGG
ATCCATGTCGAGGCGGAGGAGAAGGCCTATGGGCTGAGGGAGTGGTGGAAGGACGTGTGGAGGAGGTGGACGGGA
TAG
Gene >Ophio5|3661
ATGATGGCTTCTGCGGTTGGCCTGACGTCGCTCCGCCTCTGCTTCAGGCTCATCAGAAGAAACCCAGCCGCGGCT
GGGATATCGTACCGAGCTGGCGTGGTGGAGAGCCCGACGCCCGACCGGTCTGCACCCAAGGATGACGCAGCCCCC
GAACAGCAGCGTCGACCATTGCCAGCGTCATCGGAGCCGGGGCCGATGGCGCGACGGCTGGAGGAGGCGACGGAG
GAGGCGATTGTGAGCGGCGGCACTGCGGGCAGACGCGCCGTCGAAGAAGCCGGCTTCTCGGAGGAGCTCAAGCAG
AGACTTCTGGAGAAGGTGACCGACGCCAAGTTCAGGGAGGAGCACAAGGCGGCCTTCGTCGAGGCAGGGCTCACG
TCGGCGGCGGGCGAGGGCACGAGGCACATGGCTACTGGGCAGCCCTGGACCGGGTCTGAGACGGTCGAGGACGCG
GTTCTCAGGATGTTGGACGACGCGAAGCGGCCCTTGAAGCCCGAATTGCGTGGCAAATTCGAAGCGCCAGCAGGA
GCGAGGCCTCTCAAGAGGCGTCGAGTCGAGAAGGCTGGACAACGAGCGGCAAGCGCGCGAGACCAAGCGGCCTTG
TATACAGAATTGGGTATCGGGTCCTCCAAGGGATTGAGCGAGGCTGAGAGAGAGGATATGAAGAGGGAGTTTCGG
GAGAGGTTCCAGCCCGCAGCGCGGTCGATTCCAGTCTCCGTCTCAGGGCTGGCGGCTCTGGCCAACGAGAGGATC
GAGGACGCCATCGCAAGAGGGCAGTTCAAGGACCTGCCGCGAGGCAAGGCGGTGGAGGCGGACCCGCAGGCGGCG
AGCCCCTTTATCGACACAACCGAGTACCTCTTGAACAGAATAATCAAGCGACAGGAAATTGTGCCACCGTGGATT
GAGAAGCAGCAGGAGCTCGGCAGGGCGGCGCGCGTCTTCCGCGAACGGCTGCGAAACGACTGGAAGCGTCACGCG
GCGAGGATGATGACCGCCAGGGGGGGCTCGCTGAAAGAACAGATGAGGAGGGCGGAAGAGTACGCGGCGGCGGAG
AGAAAGTACGTTGCGCAAAACAAAGGCTCGGACGAGAACATGTCTGCGCCGGCGTCGGACGACCCGGTCGGTGCA
GAGGCGCATCCCTTCCGCGACGCAGACTGGGAGCGGGTCGAGTCCGCGTACATGAAGCTGTCGATCGAGAAGCTC
AACGACCTGACGAGGAGCTACAATTTGATGGCACCGGACGTGGCGAGGAAGCCCTACTGGGCACTGAGGAGGGAG
CTGGACGCGTGCTTTGCAGAAGTGGCGCCGCTACTGGCTGACGAGATTAGGCAGAGAGCCGGCGCGAGGGCGGCT
CCGCTTCCTGGCCGGCCGGTTGAGAGACGAGGCGAGGGATTCGTAGAGCAGTGGAGGGGTAGAGACGATGTTAGG
ATCCATGTCGAGGCGGAGGAGAAGGCCTATGGGCTGAGGGAGTGGTGGAAGGACGTGTGGAGGAGGTGGACGGGA
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail