Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3660
Gene name
Locationscaffold_29:23668..25626
Strand-
Gene length (bp)1958
Transcript length (bp)1686
Coding sequence length (bp)1683
Protein length (aa) 561

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.3E-86 63 519
PF07690 MFS_1 Major Facilitator Superfamily 9.4E-09 112 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 3 547 2.0E-148
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 3 547 1.0E-147
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 6 559 6.0E-142
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 6 559 8.0E-142
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 6 559 8.0E-142
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 3 547 2.0E-148
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 3 547 1.0E-147
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 6 559 6.0E-142
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 6 559 8.0E-142
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 6 559 8.0E-142
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 6 536 2.0E-141
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 6 536 3.0E-141
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 3 536 2.0E-140
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 53 523 5.0E-27
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 55 527 1.0E-26
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 73 523 1.0E-25
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 25 530 4.0E-25
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 56 530 4.0E-25
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 25 530 4.0E-25
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 73 523 1.0E-24
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 73 523 1.0E-24
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 73 538 2.0E-24
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 65 530 2.0E-24
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 5 530 2.0E-23
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 14 521 3.0E-23
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 165 543 3.0E-23
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 8 530 8.0E-23
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 65 530 8.0E-23
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 2 538 9.0E-23
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 15 520 1.0E-22
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 87 519 2.0E-22
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 13 521 3.0E-22
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 52 530 4.0E-22
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 63 523 6.0E-22
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 118 517 7.0E-22
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 87 519 1.0E-21
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 63 542 2.0E-21
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 71 530 3.0E-21
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 66 522 1.0E-20
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 87 561 1.0E-20
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 58 521 3.0E-20
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 71 530 2.0E-19
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 70 547 2.0E-19
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 165 543 3.0E-19
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 71 523 4.0E-19
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 46 555 5.0E-19
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 165 522 5.0E-19
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 165 522 5.0E-19
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 71 530 6.0E-19
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 71 516 7.0E-19
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 117 522 1.0E-18
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 63 523 1.0E-18
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 73 521 2.0E-18
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 165 543 2.0E-18
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 1 523 3.0E-18
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 165 559 4.0E-18
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 46 555 5.0E-18
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 66 522 9.0E-18
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 116 524 1.0E-17
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 117 539 1.0E-17
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 87 523 2.0E-17
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 73 521 3.0E-17
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 73 522 3.0E-17
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 46 555 3.0E-17
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 165 543 3.0E-17
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 58 520 4.0E-17
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 117 522 4.0E-17
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 117 549 7.0E-17
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 117 522 7.0E-17
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 101 516 9.0E-17
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 116 522 2.0E-16
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 116 522 5.0E-16
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 156 522 1.0E-15
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 73 408 2.0E-15
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 101 516 2.0E-15
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 97 522 2.0E-15
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 58 534 3.0E-15
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 117 522 5.0E-15
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 58 521 7.0E-15
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 107 544 7.0E-15
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 58 527 8.0E-15
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 117 532 8.0E-15
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 97 522 9.0E-15
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 117 537 1.0E-14
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 126 333 1.0E-14
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 16 520 3.0E-14
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 117 538 3.0E-14
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 117 516 4.0E-14
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 53 522 6.0E-14
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 117 537 6.0E-14
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 73 525 7.0E-14
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 114 533 8.0E-14
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 117 537 8.0E-14
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 185 530 1.0E-13
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 56 516 1.0E-13
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 116 516 1.0E-13
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 68 530 2.0E-13
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 117 537 2.0E-13
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 73 403 5.0E-13
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 73 519 5.0E-13
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 133 401 5.0E-13
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 129 519 6.0E-13
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 118 517 6.0E-13
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 117 527 7.0E-13
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 118 547 1.0E-12
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 73 525 1.0E-12
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 92 393 1.0E-12
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 117 381 2.0E-12
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 117 516 2.0E-12
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 133 401 3.0E-12
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 117 527 4.0E-12
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 101 516 5.0E-12
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 101 516 5.0E-12
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 117 521 6.0E-12
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 144 521 7.0E-12
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 118 522 1.0E-11
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 115 517 1.0E-11
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 73 516 1.0E-11
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 126 279 2.0E-11
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 118 517 4.0E-11
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 115 519 4.0E-11
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 117 524 5.0E-11
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 144 521 8.0E-11
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 117 524 1.0E-10
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 115 519 1.0E-10
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 116 516 1.0E-10
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 160 557 2.0E-10
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 65 516 3.0E-10
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 111 520 4.0E-10
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 160 557 4.0E-10
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 156 542 5.0E-10
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 101 279 1.0E-09
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 117 523 2.0E-09
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 111 442 2.0E-09
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 107 504 2.0E-09
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 115 531 3.0E-09
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 115 531 3.0E-09
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 131 516 4.0E-09
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 131 516 4.0E-09
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 101 346 5.0E-09
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 128 521 6.0E-09
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 156 522 6.0E-09
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 62 397 1.0E-08
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 118 398 1.0E-08
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 111 403 1.0E-08
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 118 519 1.0E-08
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 130 398 2.0E-08
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 50 387 2.0E-08
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 93 397 3.0E-08
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 63 520 4.0E-08
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 157 522 4.0E-08
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 93 356 4.0E-08
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 70 541 7.0E-08
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 126 291 7.0E-08
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 131 516 8.0E-08
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 73 521 8.0E-08
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 131 516 1.0E-07
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 131 516 1.0E-07
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 63 401 1.0E-07
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 38 280 2.0E-07
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 116 403 2.0E-07
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 116 346 2.0E-07
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 116 346 2.0E-07
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 129 398 3.0E-07
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 70 413 3.0E-07
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 107 517 3.0E-07
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 53 316 4.0E-07
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 100 516 4.0E-07
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 53 280 5.0E-07
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 63 516 6.0E-07
sp|P38055|YDJE_ECOLI Inner membrane metabolite transport protein YdjE OS=Escherichia coli (strain K12) GN=ydjE PE=1 SV=2 108 472 6.0E-07
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 93 514 8.0E-07
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 131 516 9.0E-07
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 117 516 1.0E-06
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 117 519 1.0E-06
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 109 407 2.0E-06
sp|Q5EXK5|MHBT_KLEOX 3-hydroxybenzoate transporter MhbT OS=Klebsiella oxytoca GN=mhbT PE=1 SV=1 127 287 2.0E-06
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 120 281 2.0E-06
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 131 516 2.0E-06
sp|Q8HY24|S22A8_RABIT Solute carrier family 22 member 8 OS=Oryctolagus cuniculus GN=SLC22A8 PE=2 SV=1 118 325 2.0E-06
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 131 516 3.0E-06
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 131 516 4.0E-06
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 131 516 5.0E-06
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 118 349 7.0E-06
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 111 268 8.0E-06
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 100 535 9.0E-06
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 117 316 9.0E-06
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 118 284 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 133 155 22
2 162 184 22
3 234 256 22
4 382 404 22
5 419 439 20
6 452 474 22
7 484 502 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3660
MTLDSAPPSAAPDDGDKKDTGCEDAAPLRRTVVDNARAAASKERSMTLLQGLRLYPKAVAWSLLISTCIVMEGYD
ISLVNNFYAFPQFKRKYGALLEDGTYEVSAPWQAGLSNGAQVGEIIGLFINGFVSERFGYRYTVLACLALVAAFT
AIFFTAPNVQTLLVAEILCGVPWGIFQTLTVTYASEVCPIALRGYLTTYVNFCWGLGQEIGIGVIRSMLHRNDEW
GFRIPYALQWMWPVPLFVGVCFAPESPWWLVRRGRIDEAKRSLLRLTSRDRETDFDVDETVAMMVHTTALEEKMT
AGATYWDCFKGTDLRRTEVVCMTWAIQNLSGNSFSNYSTYFLKQAGLPEETSYSFALGQYAINMVGVFGAWGLMT
LGAGRRSLYLYGLCGLCVMLFILGFLGLVPERQRPMASLATGSIMIVWALIYQLTVGTVCYSLVSELSSRRLQIK
TVVLGRNLYNVVGIITGVLTPYMLNPSEWNWRNFTGFFWAGICFFCVVYTYFRLPEPRGRTFAELDVLFDKRISA
RKFASTEVDVFHEKLEETVMNEYETIIDSRPPGEKA
Coding >Ophio5|3660
ATGACCCTCGACTCCGCCCCGCCATCGGCCGCGCCCGATGACGGCGATAAGAAAGACACCGGCTGCGAAGACGCG
GCCCCCCTGCGCCGCACCGTCGTCGACAATGCCCGCGCTGCCGCCTCCAAGGAGCGCTCCATGACGCTTCTCCAG
GGCCTTAGGCTCTACCCCAAGGCTGTCGCCTGGAGCCTTCTCATCTCCACCTGCATAGTCATGGAGGGGTACGAC
ATCAGTCTCGTCAACAACTTCTATGCTTTCCCTCAATTTAAGCGCAAATATGGCGCGCTACTCGAGGATGGCACC
TACGAAGTTTCCGCCCCCTGGCAGGCAGGCTTGAGCAACGGCGCCCAAGTCGGCGAAATTATCGGTCTTTTTATC
AATGGCTTCGTCTCGGAGCGCTTCGGCTACCGCTATACCGTCCTGGCCTGTCTGGCTCTCGTCGCTGCCTTCACC
GCCATCTTCTTCACCGCGCCCAACGTTCAAACCCTGCTTGTCGCCGAAATACTGTGCGGCGTCCCCTGGGGGATC
TTCCAGACCCTGACCGTCACCTATGCCTCCGAAGTCTGCCCAATTGCTCTGCGCGGCTACCTCACCACCTACGTC
AACTTCTGCTGGGGCCTCGGGCAGGAAATCGGCATCGGTGTCATCCGGTCCATGCTGCATCGCAACGACGAGTGG
GGGTTCCGCATACCTTACGCCCTGCAATGGATGTGGCCGGTTCCGCTCTTCGTCGGCGTCTGCTTCGCCCCCGAG
TCCCCTTGGTGGCTGGTCCGCAGGGGCAGGATCGACGAGGCCAAGAGATCCCTCCTGCGCCTAACCAGCCGAGAC
CGCGAGACTGACTTTGACGTCGACGAGACGGTCGCCATGATGGTTCACACCACGGCGCTCGAGGAGAAGATGACG
GCTGGAGCCACCTATTGGGACTGCTTCAAGGGCACTGACCTGCGTCGCACCGAGGTTGTCTGCATGACTTGGGCC
ATCCAAAACCTCAGCGGCAACTCCTTTTCCAACTATTCGACCTACTTTCTCAAGCAGGCTGGGCTGCCCGAGGAG
ACGTCCTACTCATTCGCCTTGGGTCAATATGCCATCAACATGGTAGGTGTCTTCGGTGCCTGGGGTCTCATGACT
CTGGGTGCCGGCCGGAGGTCTCTTTACCTCTACGGGCTGTGCGGACTCTGCGTCATGCTCTTTATCCTCGGCTTT
CTCGGCCTCGTGCCCGAGAGACAACGTCCGATGGCGTCGCTGGCCACGGGCAGCATTATGATCGTTTGGGCCTTA
ATCTACCAGCTCACTGTTGGCACGGTGTGCTATTCGCTGGTCAGCGAGCTGTCCTCGCGTCGGCTGCAGATCAAG
ACGGTGGTACTGGGAAGGAATCTTTACAACGTCGTGGGCATCATAACCGGCGTCTTGACGCCCTACATGCTGAAT
CCGAGCGAGTGGAATTGGAGAAACTTCACCGGCTTCTTCTGGGCCGGCATATGCTTCTTTTGTGTCGTATACACG
TATTTCCGTCTGCCGGAACCCAGAGGTCGAACGTTCGCAGAGCTTGACGTGCTGTTCGACAAGCGGATCAGTGCC
CGCAAGTTTGCCTCGACCGAGGTGGATGTCTTTCACGAGAAATTGGAGGAGACTGTGATGAACGAGTACGAGACC
ATCATCGACTCGCGGCCGCCCGGCGAGAAGGCT
Transcript >Ophio5|3660
ATGACCCTCGACTCCGCCCCGCCATCGGCCGCGCCCGATGACGGCGATAAGAAAGACACCGGCTGCGAAGACGCG
GCCCCCCTGCGCCGCACCGTCGTCGACAATGCCCGCGCTGCCGCCTCCAAGGAGCGCTCCATGACGCTTCTCCAG
GGCCTTAGGCTCTACCCCAAGGCTGTCGCCTGGAGCCTTCTCATCTCCACCTGCATAGTCATGGAGGGGTACGAC
ATCAGTCTCGTCAACAACTTCTATGCTTTCCCTCAATTTAAGCGCAAATATGGCGCGCTACTCGAGGATGGCACC
TACGAAGTTTCCGCCCCCTGGCAGGCAGGCTTGAGCAACGGCGCCCAAGTCGGCGAAATTATCGGTCTTTTTATC
AATGGCTTCGTCTCGGAGCGCTTCGGCTACCGCTATACCGTCCTGGCCTGTCTGGCTCTCGTCGCTGCCTTCACC
GCCATCTTCTTCACCGCGCCCAACGTTCAAACCCTGCTTGTCGCCGAAATACTGTGCGGCGTCCCCTGGGGGATC
TTCCAGACCCTGACCGTCACCTATGCCTCCGAAGTCTGCCCAATTGCTCTGCGCGGCTACCTCACCACCTACGTC
AACTTCTGCTGGGGCCTCGGGCAGGAAATCGGCATCGGTGTCATCCGGTCCATGCTGCATCGCAACGACGAGTGG
GGGTTCCGCATACCTTACGCCCTGCAATGGATGTGGCCGGTTCCGCTCTTCGTCGGCGTCTGCTTCGCCCCCGAG
TCCCCTTGGTGGCTGGTCCGCAGGGGCAGGATCGACGAGGCCAAGAGATCCCTCCTGCGCCTAACCAGCCGAGAC
CGCGAGACTGACTTTGACGTCGACGAGACGGTCGCCATGATGGTTCACACCACGGCGCTCGAGGAGAAGATGACG
GCTGGAGCCACCTATTGGGACTGCTTCAAGGGCACTGACCTGCGTCGCACCGAGGTTGTCTGCATGACTTGGGCC
ATCCAAAACCTCAGCGGCAACTCCTTTTCCAACTATTCGACCTACTTTCTCAAGCAGGCTGGGCTGCCCGAGGAG
ACGTCCTACTCATTCGCCTTGGGTCAATATGCCATCAACATGGTAGGTGTCTTCGGTGCCTGGGGTCTCATGACT
CTGGGTGCCGGCCGGAGGTCTCTTTACCTCTACGGGCTGTGCGGACTCTGCGTCATGCTCTTTATCCTCGGCTTT
CTCGGCCTCGTGCCCGAGAGACAACGTCCGATGGCGTCGCTGGCCACGGGCAGCATTATGATCGTTTGGGCCTTA
ATCTACCAGCTCACTGTTGGCACGGTGTGCTATTCGCTGGTCAGCGAGCTGTCCTCGCGTCGGCTGCAGATCAAG
ACGGTGGTACTGGGAAGGAATCTTTACAACGTCGTGGGCATCATAACCGGCGTCTTGACGCCCTACATGCTGAAT
CCGAGCGAGTGGAATTGGAGAAACTTCACCGGCTTCTTCTGGGCCGGCATATGCTTCTTTTGTGTCGTATACACG
TATTTCCGTCTGCCGGAACCCAGAGGTCGAACGTTCGCAGAGCTTGACGTGCTGTTCGACAAGCGGATCAGTGCC
CGCAAGTTTGCCTCGACCGAGGTGGATGTCTTTCACGAGAAATTGGAGGAGACTGTGATGAACGAGTACGAGACC
ATCATCGACTCGCGGCCGCCCGGCGAGAAGGCTTGA
Gene >Ophio5|3660
ATGACCCTCGACTCCGCCCCGCCATCGGCCGCGCCCGATGACGGCGATAAGAAAGACACCGGCTGCGAAGACGCG
GCCCCCCTGCGCCGCACCGTCGTCGACAATGCCCGCGCTGCCGCCTCCAAGGAGCGCTCCATGACGCTTCTCCAG
GGCCTTAGGCTCTACCCCAAGGCTGTCGCCTGGAGCCTTCTCATCTCCACCTGCATAGTCATGGAGGGGTACGAC
ATCAGTCTCGTCAACAACTTCTGTATCCTTCCCCTTCCACCTCGACCAGTGGCTCTCACCTCGGCTGACGGTAAA
ACCAACAGATGCTTTCCCTCAATTTAAGCGCAAATATGGCGCGCTACTCGAGGATGGCACCTACGAAGTTTCCGC
CCCCTGGCAGGCAGGCTTGAGCAACGTCGGTGACCCATAGCAGCCTTACTCTGCCATCCCCCACAATCCTTTCCA
GCGCTACTCAACGGACCTATGCTGACGAGATCCTCGGCCACTTTTCGCTTATAGGGCGCCCAAGTCGGCGAAATT
ATCGGTCTTTTTATCAATGGCTTCGTCTCGGAGCGCTTCGGCTACCGCTATACCGTCCTGGCCTGTCTGGCTCTC
GTCGCTGCCTTCACCGCCATCTTCTTCACCGCGCCCAACGTTCAAACCCTGCTTGTCGCCGAAATACTGTGCGGC
GTCCCCTGGGGGATCTTCCAGACCCTGACCGTCACCTATGCCTCCGAAGTCTGCCCAATTGCTCTGCGCGGCTAC
CTCACCACCTACGTCAACTTCTGCTGGGGCCTCGGGCAGGAAATCGGCATCGGTGTCATCCGGTCCATGCTGCAT
CGCAACGACGAGTGGGGGTTCCGCATACCTTACGCCCTGCAATGGATGTGGCCGGTTCCGCTCTTCGTCGGCGTC
TGCTTCGCCCCCGAGTCCCCTTGGTGGCTGGTCCGCAGGGGCAGGATCGACGAGGCCAAGAGATCCCTCCTGCGC
CTAACCAGCCGAGACCGCGAGACTGACTTTGACGTCGACGAGACGGTCGCCATGATGGTTCACACCACGGCGCTC
GAGGAGAAGATGACGGCTGGAGCCACCTATTGGGACTGCTTCAAGGGCACTGACCTGCGTCGCACCGAGGTTGTC
TGCATGACTTGGGCCATCCAAAACCTCAGCGGCAACTCCTTTTCCAACTATTCGACCTACTTTCTCAAGCAGGCT
GGGCTGCCCGAGGAGACGTCCTACTCATTCGCCTTGGGTCAATATGCCATCAACATGGTAGGTGTCTTCGGTGCC
TGGGGTCTCATGACTCTGGGTGCCGGCCGGAGGTCTCTTTACCTCTACGGGCTGTGCGGACTCTGCGTCATGCTC
TTTATCCTCGGCTTTCTCGGCCTCGTGCCCGAGAGACAACGTCCGATGGCGTCGCTGGCCACGGGCAGCATTATG
ATCGTTTGGGCCTTAATCTACCAGCTCACTGTTGGCACGGTGTGCTATTCGCTGGTCAGCGAGCTGTCCTCGCGT
CGGCTGCAGATCAAGACGGTGGTACTGGGAAGGAATCTTTAGTAGGTTGGACCGATTTTGCCCAGCCTAGAAGCA
CTTGCTGACAGAGGACGTAGCAACGTCGTGGGCATCATAACCGGCGTCTTGACGCCCTACATGCTGAATCCGAGC
GAGTGGAATTGGAGAAACTTCACCGGCTTCTTCTGGGTAAGGAGGACTATGTTGGCTTGAACTGCATAGTGCTAA
CGCCGATGTGTTAGGCCGGCATATGCTTCTTTTGTGTCGTATACACGTATTTCCGTCTGCCGGAACCCAGAGGTC
GAACGTTCGCAGAGCTTGACGTGCTGTTCGACAAGCGGATCAGTGCCCGCAAGTTTGCCTCGACCGAGGTGGATG
TCTTTCACGAGAAATTGGAGGAGACTGTGATGAACGAGTACGAGACCATCATCGACTCGCGGCCGCCCGGCGAGA
AGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail