Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3650
Gene name
Locationscaffold_289:18607..19856
Strand-
Gene length (bp)1249
Transcript length (bp)906
Coding sequence length (bp)903
Protein length (aa) 301

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07264 EI24 Etoposide-induced protein 2.4 (EI24) 3.3E-10 52 263

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08219|RRT8_YEAST Outer spore wall protein RRT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRT8 PE=1 SV=2 42 278 6.0E-16
sp|P31379|LDS1_YEAST Outer spore wall protein LDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDS1 PE=1 SV=1 42 290 4.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22
2 95 117 22
3 188 210 22
4 243 265 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3650
MADSSAPSTAGSRKSRAVKSVGDKAQHVLQEDYGKAKAVALDALRSRAYLYPVKGIFYLVTHRALWKPFLSRLGP
YVSLYVAVVGAMFFFAYLPQLAVLVFVNGPLAVVTTVVLILNESSALVNALSRNWILQDAIVDTFDGTLVARNAT
ATVSQGRELRSGADPMQRLGKILLSPFDRFSPTALVRYVMYLPLNFIPVVGTAMFLFLQGRNRGKLVHGRYFQLK
KWSASQRSHWLDEHIGPYTAFGLVATLLEMIPLASIFFTFTNTVGAALWAADIEALDTTMTDETAPTLRERAGKV
E
Coding >Ophio5|3650
ATGGCCGACTCTAGCGCGCCCTCCACGGCCGGCTCGAGGAAGAGCCGCGCCGTGAAATCGGTCGGCGACAAGGCG
CAGCATGTCCTCCAAGAGGACTACGGCAAGGCTAAGGCGGTCGCTCTGGATGCTCTGCGGAGCCGAGCATATCTT
TATCCGGTCAAGGGCATCTTCTACCTCGTCACTCATCGAGCCCTCTGGAAGCCCTTCCTCTCGCGCCTGGGGCCC
TATGTCAGCCTCTATGTCGCCGTTGTCGGCGCCATGTTCTTCTTCGCCTACCTTCCGCAGCTGGCGGTGCTCGTC
TTCGTCAACGGGCCGCTTGCTGTAGTCACTACCGTTGTGCTCATCCTCAACGAGAGCTCGGCCCTGGTAAATGCC
CTCTCCCGCAACTGGATCCTGCAGGATGCCATCGTCGACACCTTTGACGGCACGCTGGTTGCCAGGAACGCCACT
GCCACCGTCAGTCAGGGTCGCGAGCTCCGTTCCGGTGCCGATCCGATGCAGCGGCTGGGCAAGATACTCTTGAGC
CCCTTTGATCGCTTCAGTCCTACCGCCCTGGTGCGCTATGTCATGTATCTACCGCTCAACTTCATCCCCGTCGTT
GGCACCGCCATGTTTCTGTTTCTGCAGGGTCGCAATCGTGGAAAGCTGGTCCATGGCCGCTACTTCCAACTCAAG
AAGTGGTCGGCGTCTCAGCGGTCGCATTGGCTGGATGAGCACATCGGCCCTTACACGGCGTTCGGACTGGTTGCG
ACGCTACTGGAGATGATTCCCCTGGCTTCCATCTTCTTCACCTTTACCAACACCGTGGGCGCGGCGCTGTGGGCG
GCTGACATAGAGGCTCTCGACACGACCATGACGGACGAGACTGCCCCGACGCTGAGGGAGAGGGCGGGCAAGGTC
GAG
Transcript >Ophio5|3650
ATGGCCGACTCTAGCGCGCCCTCCACGGCCGGCTCGAGGAAGAGCCGCGCCGTGAAATCGGTCGGCGACAAGGCG
CAGCATGTCCTCCAAGAGGACTACGGCAAGGCTAAGGCGGTCGCTCTGGATGCTCTGCGGAGCCGAGCATATCTT
TATCCGGTCAAGGGCATCTTCTACCTCGTCACTCATCGAGCCCTCTGGAAGCCCTTCCTCTCGCGCCTGGGGCCC
TATGTCAGCCTCTATGTCGCCGTTGTCGGCGCCATGTTCTTCTTCGCCTACCTTCCGCAGCTGGCGGTGCTCGTC
TTCGTCAACGGGCCGCTTGCTGTAGTCACTACCGTTGTGCTCATCCTCAACGAGAGCTCGGCCCTGGTAAATGCC
CTCTCCCGCAACTGGATCCTGCAGGATGCCATCGTCGACACCTTTGACGGCACGCTGGTTGCCAGGAACGCCACT
GCCACCGTCAGTCAGGGTCGCGAGCTCCGTTCCGGTGCCGATCCGATGCAGCGGCTGGGCAAGATACTCTTGAGC
CCCTTTGATCGCTTCAGTCCTACCGCCCTGGTGCGCTATGTCATGTATCTACCGCTCAACTTCATCCCCGTCGTT
GGCACCGCCATGTTTCTGTTTCTGCAGGGTCGCAATCGTGGAAAGCTGGTCCATGGCCGCTACTTCCAACTCAAG
AAGTGGTCGGCGTCTCAGCGGTCGCATTGGCTGGATGAGCACATCGGCCCTTACACGGCGTTCGGACTGGTTGCG
ACGCTACTGGAGATGATTCCCCTGGCTTCCATCTTCTTCACCTTTACCAACACCGTGGGCGCGGCGCTGTGGGCG
GCTGACATAGAGGCTCTCGACACGACCATGACGGACGAGACTGCCCCGACGCTGAGGGAGAGGGCGGGCAAGGTC
GAGTGA
Gene >Ophio5|3650
ATGGCCGACTCTAGCGCGCCCTCCACGGCCGGCTCGAGGAAGAGCCGCGCCGTGAAATCGGTCGGCGACAAGGCG
CAGCATGTCCTGTATGCCCCGCCCCCCACTCCCCCCGCCTTCTGTCTGTCCGGATGATACTGAAAGGGCGCGCCG
TAGCCAAGAGGACTACGGCAAGGCTAAGGCGGTCGCTCTGGATGCTCTGCGGAGCCGAGCATATCTTTATCCGGT
CAAGGTAGACTGAACGAATGACTCGGGGCACACGACAAGGGCTGACACGGCCGCCTGTAGGGCATCTTCTACCTC
GTCACTCATCGAGCCCTCTGGAAGCCCTTCCTCTCGCGCCTGGGGCCCTATGTCAGCCTCTATGTCGCCGTTGTC
GGCGCCATGTTCTTCTTCGCCTACCTTCCGCAGCTGGCGGTGCTCGTCTTCGTCAACGGGCCGCTTGCTGTAGTC
ACTACCGTTGTGCTCATCCTCAACGAGAGCTCGGCCCTGGTAAATGCCCTCTCCCGCAACTGGATCCTGCAGGAT
GCCATCGTCGACACCTTTGACGGCACGCTGGTTGCCAGGAACGCCACTGCCACCGTCAGTCAGGGTCGCGAGCTC
CGTTCCGGTGCCGATCCGATGCAGCGGCTGGGCAAGATACTCTTGAGCCCCTTTGATCGCTTCAGTCCTACCGCC
CTGGTGCGCTATGTCATGTATCTACCGCTCAACTTCATCCCCGTCGTTGGCACCGCCATGTTTCTGTTTCTGCAG
GGTCGCAATCGTGGAAAGCTGGTCCATGGCCGCGTGAGTCATACCGTCTCCATCACATCAGCCTGTCTGACGACG
ACGCTTACATGCTTGCTGCAGTACTTCCAACTCAAGAAGTGGTCGGCGTCTCAGCGGTCGCATTGGCTGGATGAG
CACATCGGCCCTTACACGGCGTAGGTTCCAACGCCCCGGTAGCGGGGAGGGGCGTGCAGACGCCTGGTGGACGAC
TTCCGAGCTGTGGCTCGCTAACGTGCATGGCGTCTCAGGTTCGGACTGGTTGCGACGCTACTGGAGATGATTCCC
CTGGCTTCCATCTTCTTCACCTTTACCAACACCGGTAAGCTAGCTGCCTTTCATTTGCCTTGGCGGTAGCCGTGA
ACTTGGTCTGATCAGTATACTAGTGGGCGCGGCGCTGTGGGCGGCTGACATAGAGGCTCTCGACACGACCATGAC
GGACGAGACTGCCCCGACGCTGAGGGAGAGGGCGGGCAAGGTCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail