Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3644
Gene name
Locationscaffold_289:2987..4970
Strand+
Gene length (bp)1983
Transcript length (bp)1833
Coding sequence length (bp)1830
Protein length (aa) 610

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01039 Carboxyl_trans Carboxyl transferase domain 5.4E-138 133 596

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3ULD5|MCCB_MOUSE Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Mccc2 PE=1 SV=1 81 610 0.0E+00
sp|Q9V9A7|MCCB_DROME Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Drosophila melanogaster GN=l(2)04524 PE=2 SV=1 64 610 0.0E+00
sp|Q9LDD8|MCCB_ARATH Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Arabidopsis thaliana GN=MCCB PE=2 SV=1 80 610 0.0E+00
sp|Q8T2J9|MCCB_DICDI Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Dictyostelium discoideum GN=mccb PE=3 SV=2 73 610 0.0E+00
sp|Q9HCC0|MCCB_HUMAN Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=MCCC2 PE=1 SV=1 65 610 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3ULD5|MCCB_MOUSE Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Mccc2 PE=1 SV=1 81 610 0.0E+00
sp|Q9V9A7|MCCB_DROME Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Drosophila melanogaster GN=l(2)04524 PE=2 SV=1 64 610 0.0E+00
sp|Q9LDD8|MCCB_ARATH Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Arabidopsis thaliana GN=MCCB PE=2 SV=1 80 610 0.0E+00
sp|Q8T2J9|MCCB_DICDI Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Dictyostelium discoideum GN=mccb PE=3 SV=2 73 610 0.0E+00
sp|Q9HCC0|MCCB_HUMAN Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=MCCC2 PE=1 SV=1 65 610 0.0E+00
sp|P34385|MCCB_CAEEL Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Caenorhabditis elegans GN=F02A9.4 PE=3 SV=1 89 610 0.0E+00
sp|Q5XIT9|MCCB_RAT Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus GN=Mccc2 PE=2 SV=1 71 610 0.0E+00
sp|O31825|YNGE_BACSU Uncharacterized carboxylase YngE OS=Bacillus subtilis (strain 168) GN=yngE PE=3 SV=2 118 592 7.0E-99
sp|Q8GBW6|12S_PROFR Methylmalonyl-CoA carboxyltransferase 12S subunit OS=Propionibacterium freudenreichii subsp. shermanii PE=1 SV=3 102 589 3.0E-72
sp|P54541|PCCB_BACSU Putative propionyl-CoA carboxylase beta chain OS=Bacillus subtilis (strain 168) GN=yqjD PE=3 SV=2 107 584 2.0E-68
sp|P53003|PCCB_SACEN Propionyl-CoA carboxylase beta chain OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pccB PE=3 SV=2 95 588 6.0E-68
sp|Q3J4E3|PCCB_RHOS4 Propionyl-CoA carboxylase beta chain OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pccB PE=1 SV=1 124 601 1.0E-67
sp|P9WQH7|PCC5_MYCTU Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accD5 PE=1 SV=1 125 588 2.0E-61
sp|P9WQH6|PCC5_MYCTO Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accD5 PE=3 SV=1 125 588 2.0E-61
sp|P07633|PCCB_RAT Propionyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus GN=Pccb PE=2 SV=1 124 589 6.0E-61
sp|P79384|PCCB_PIG Propionyl-CoA carboxylase beta chain, mitochondrial OS=Sus scrofa GN=PCCB PE=2 SV=1 124 588 1.0E-60
sp|Q99MN9|PCCB_MOUSE Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Pccb PE=1 SV=2 124 589 2.0E-60
sp|P05166|PCCB_HUMAN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=PCCB PE=1 SV=3 101 588 2.0E-60
sp|P53002|PCCB_MYCLE Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium leprae (strain TN) GN=accD5 PE=3 SV=1 135 588 2.0E-59
sp|Q2TBR0|PCCB_BOVIN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Bos taurus GN=PCCB PE=2 SV=1 124 588 2.0E-59
sp|Q06101|PCCB_RHOER Propionyl-CoA carboxylase beta chain OS=Rhodococcus erythropolis GN=pccB PE=3 SV=1 141 551 2.0E-41
sp|P9WQH5|PCC6_MYCTU Probable propionyl-CoA carboxylase beta chain 6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accD6 PE=1 SV=1 149 600 3.0E-40
sp|P9WQH4|PCC6_MYCTO Probable propionyl-CoA carboxylase beta chain 6 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accD6 PE=1 SV=1 149 600 3.0E-40
sp|P63408|PCC6_MYCBO Probable propionyl-CoA carboxylase beta chain 6 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accD6 PE=3 SV=1 149 600 3.0E-40
sp|Q06700|GCDA_ACIFV Glutaconyl-CoA decarboxylase subunit alpha OS=Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4) GN=gcdA PE=1 SV=1 103 568 1.0E-36
sp|Q83KA2|ACCD_SHIFL Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Shigella flexneri GN=accD PE=3 SV=4 138 315 5.0E-07
sp|Q3A6L1|ACCD_PELCD Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=accD PE=3 SV=1 138 306 6.0E-07
sp|C4Z8P1|ACCDA_EUBR3 Acetyl-coenzyme A carboxylase carboxyl transferase subunits beta/alpha OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=accD PE=3 SV=1 176 548 1.0E-06
sp|Q5QUD9|ACCD_IDILO Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=accD PE=3 SV=1 177 360 2.0E-06
sp|A7MH52|ACCD_CROS8 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=accD PE=3 SV=2 138 374 2.0E-06
sp|Q0RKW5|ACCDA_FRAAA Acetyl-coenzyme A carboxylase carboxyl transferase subunits beta/alpha OS=Frankia alni (strain ACN14a) GN=accD PE=3 SV=1 182 541 4.0E-06
sp|B1VKF0|ACCD_CRYJA Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cryptomeria japonica GN=accD PE=3 SV=1 176 317 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3644
MRESARISPRSIQRQANRTPTSQIAKSLNLDLLLLFHLHQTHKPPPPPHLVTMLRPSPSPTSRRAALVLVRRSVS
RLTPVHQATTVSRLPSTVDASTDDFRNNARQMDEMVSRMQLLTRQAQRGGSDSARARHLARNRMLPRDRITALLD
PASSFLELSPLAGYELYPEADVPAGGIITGLGQVEGVTCVVVANDSTVKGGSYYPITVKKHLRAQAVAQENNLPC
IYLVDSGGANLPHQADVFPDQNHFGRIFYNQARMSARGIPQISVVMGPCTAGGAYVPAMSDEAIIVRDQGHIFLA
GPPLVKAATGEVVSPEDLGGGLMHSSVSGVTDYLAADDAHALVLARRCVANLNWPPCSATTPIREDEPPLYDPDE
LLGIASPNLRKPLPIRDVIARIVDGSRFSEFKALFGTTLVTGFATIHGHPVGIVANDGILFAASAVKGAHFVQLC
AQRGLPLVFLQNIAGFMVGAAAERDGIAKHGAKFVTAVACADVPKFTVVVGGSYGAGNYGMCGRAYSPRFLWMWP
NARIGVMGGEQLAAVMETVGQKADPELKARIERESDATYSSARLWDDGIIPPQHTRRYLALGLSAAMGGRNKVQP
NETRYGVFRM
Coding >Ophio5|3644
ATGCGCGAGTCCGCCCGCATCTCACCTCGCTCAATTCAACGTCAGGCCAATCGCACGCCAACATCTCAAATCGCC
AAAAGCCTCAATCTCGACCTCCTCCTCCTGTTCCACCTTCACCAAACTCACAAACCCCCCCCCCCACCCCATCTC
GTCACCATGCTGCGCCCGTCGCCGTCCCCGACGTCTCGACGGGCCGCCCTCGTCCTCGTACGGCGCAGCGTGTCC
CGCCTCACGCCCGTTCATCAAGCGACGACCGTCTCTCGGCTCCCGTCGACCGTCGACGCTTCGACCGACGACTTT
CGAAATAATGCTCGGCAGATGGACGAGATGGTCTCGCGTATGCAGCTGCTTACTCGCCAGGCGCAGAGAGGCGGT
TCGGATTCCGCTAGGGCTCGTCACCTCGCCCGTAATCGCATGCTGCCGCGAGATAGGATCACTGCTTTGCTCGAT
CCTGCTTCCTCCTTTCTTGAGCTTTCGCCTCTTGCCGGCTATGAGCTTTATCCCGAGGCCGACGTTCCCGCGGGG
GGCATCATCACCGGCCTCGGTCAGGTTGAGGGTGTTACCTGTGTCGTCGTCGCCAATGATAGTACCGTCAAGGGC
GGCTCTTATTATCCCATCACTGTCAAGAAACATTTACGCGCCCAGGCCGTCGCCCAAGAGAATAACCTTCCCTGC
ATCTACCTCGTCGACTCCGGCGGCGCCAACCTCCCTCATCAAGCCGACGTCTTCCCCGATCAGAACCATTTCGGT
CGCATCTTCTACAACCAAGCCCGTATGTCCGCCCGCGGCATTCCCCAAATCTCCGTCGTCATGGGCCCCTGCACC
GCCGGTGGCGCCTACGTCCCCGCCATGAGCGACGAGGCCATCATCGTCCGGGACCAGGGCCACATCTTCCTCGCA
GGACCGCCCCTCGTCAAGGCCGCCACCGGAGAGGTCGTCTCCCCGGAGGACCTCGGCGGCGGTCTCATGCACTCA
TCCGTCTCCGGCGTCACCGATTATCTCGCCGCCGACGACGCCCACGCCCTCGTCCTCGCCCGTCGTTGTGTCGCC
AACCTCAACTGGCCCCCTTGCTCTGCTACGACCCCTATCCGAGAAGACGAACCCCCCTTATACGATCCGGACGAA
CTCCTCGGCATCGCCTCTCCCAACCTCCGCAAGCCCCTCCCCATCCGCGACGTCATCGCTCGCATCGTCGACGGC
TCCCGCTTCTCCGAATTCAAAGCCTTATTCGGAACGACCCTCGTGACCGGCTTCGCCACCATACACGGTCACCCC
GTCGGCATCGTCGCCAACGACGGCATCCTCTTTGCCGCCTCCGCCGTCAAGGGCGCCCACTTCGTCCAGCTCTGC
GCCCAGCGCGGCCTTCCCCTCGTCTTCCTCCAGAACATTGCCGGCTTCATGGTCGGCGCTGCCGCCGAGCGTGAC
GGCATCGCCAAGCACGGCGCCAAGTTCGTCACCGCCGTCGCTTGCGCCGACGTCCCCAAGTTCACCGTCGTCGTC
GGCGGATCGTACGGCGCCGGAAACTACGGCATGTGCGGTCGCGCCTACAGCCCGCGCTTCCTCTGGATGTGGCCA
AACGCCCGCATCGGCGTCATGGGCGGCGAGCAGCTCGCCGCCGTCATGGAGACCGTCGGCCAAAAGGCCGACCCG
GAGCTCAAGGCCCGTATCGAGCGCGAGAGCGACGCCACCTACTCCTCCGCCCGCCTCTGGGACGATGGCATCATC
CCGCCCCAACACACCCGCCGCTACCTTGCCCTGGGCCTCAGCGCCGCCATGGGAGGCCGCAACAAGGTCCAGCCC
AATGAGACACGCTACGGCGTCTTCCGCATG
Transcript >Ophio5|3644
ATGCGCGAGTCCGCCCGCATCTCACCTCGCTCAATTCAACGTCAGGCCAATCGCACGCCAACATCTCAAATCGCC
AAAAGCCTCAATCTCGACCTCCTCCTCCTGTTCCACCTTCACCAAACTCACAAACCCCCCCCCCCACCCCATCTC
GTCACCATGCTGCGCCCGTCGCCGTCCCCGACGTCTCGACGGGCCGCCCTCGTCCTCGTACGGCGCAGCGTGTCC
CGCCTCACGCCCGTTCATCAAGCGACGACCGTCTCTCGGCTCCCGTCGACCGTCGACGCTTCGACCGACGACTTT
CGAAATAATGCTCGGCAGATGGACGAGATGGTCTCGCGTATGCAGCTGCTTACTCGCCAGGCGCAGAGAGGCGGT
TCGGATTCCGCTAGGGCTCGTCACCTCGCCCGTAATCGCATGCTGCCGCGAGATAGGATCACTGCTTTGCTCGAT
CCTGCTTCCTCCTTTCTTGAGCTTTCGCCTCTTGCCGGCTATGAGCTTTATCCCGAGGCCGACGTTCCCGCGGGG
GGCATCATCACCGGCCTCGGTCAGGTTGAGGGTGTTACCTGTGTCGTCGTCGCCAATGATAGTACCGTCAAGGGC
GGCTCTTATTATCCCATCACTGTCAAGAAACATTTACGCGCCCAGGCCGTCGCCCAAGAGAATAACCTTCCCTGC
ATCTACCTCGTCGACTCCGGCGGCGCCAACCTCCCTCATCAAGCCGACGTCTTCCCCGATCAGAACCATTTCGGT
CGCATCTTCTACAACCAAGCCCGTATGTCCGCCCGCGGCATTCCCCAAATCTCCGTCGTCATGGGCCCCTGCACC
GCCGGTGGCGCCTACGTCCCCGCCATGAGCGACGAGGCCATCATCGTCCGGGACCAGGGCCACATCTTCCTCGCA
GGACCGCCCCTCGTCAAGGCCGCCACCGGAGAGGTCGTCTCCCCGGAGGACCTCGGCGGCGGTCTCATGCACTCA
TCCGTCTCCGGCGTCACCGATTATCTCGCCGCCGACGACGCCCACGCCCTCGTCCTCGCCCGTCGTTGTGTCGCC
AACCTCAACTGGCCCCCTTGCTCTGCTACGACCCCTATCCGAGAAGACGAACCCCCCTTATACGATCCGGACGAA
CTCCTCGGCATCGCCTCTCCCAACCTCCGCAAGCCCCTCCCCATCCGCGACGTCATCGCTCGCATCGTCGACGGC
TCCCGCTTCTCCGAATTCAAAGCCTTATTCGGAACGACCCTCGTGACCGGCTTCGCCACCATACACGGTCACCCC
GTCGGCATCGTCGCCAACGACGGCATCCTCTTTGCCGCCTCCGCCGTCAAGGGCGCCCACTTCGTCCAGCTCTGC
GCCCAGCGCGGCCTTCCCCTCGTCTTCCTCCAGAACATTGCCGGCTTCATGGTCGGCGCTGCCGCCGAGCGTGAC
GGCATCGCCAAGCACGGCGCCAAGTTCGTCACCGCCGTCGCTTGCGCCGACGTCCCCAAGTTCACCGTCGTCGTC
GGCGGATCGTACGGCGCCGGAAACTACGGCATGTGCGGTCGCGCCTACAGCCCGCGCTTCCTCTGGATGTGGCCA
AACGCCCGCATCGGCGTCATGGGCGGCGAGCAGCTCGCCGCCGTCATGGAGACCGTCGGCCAAAAGGCCGACCCG
GAGCTCAAGGCCCGTATCGAGCGCGAGAGCGACGCCACCTACTCCTCCGCCCGCCTCTGGGACGATGGCATCATC
CCGCCCCAACACACCCGCCGCTACCTTGCCCTGGGCCTCAGCGCCGCCATGGGAGGCCGCAACAAGGTCCAGCCC
AATGAGACACGCTACGGCGTCTTCCGCATGTAG
Gene >Ophio5|3644
ATGCGCGAGTCCGCCCGCATCTCACCTCGCTCAATTCAACGTCAGGCCAATCGCACGCCAACATCTCAAATCGCC
AAAAGCCTCAATCTCGACCTCCTCCTCCTGTTCCACCTTCACCAAACTCACAAACCCCCCCCCCCACCCCATCTC
GTCACCATGCTGCGCCCGTCGCCGTCCCCGACGTCTCGACGGGCCGCCCTCGTCCTCGTACGGCGCAGCGTGTCC
CGCCTCACGCCCGTTCATCAAGCGACGACCGTCTCTCGGCTCCCGTCGACCGTCGACGCTTCGACCGACGACTTT
CGAAATAATGCTCGGCAGATGGACGAGATGGTCTCGCGTATGCAGCTGCTTACTCGCCAGGCGCAGAGAGGCGGT
TCGGATTCCGCTAGGGCTCGTCACCTCGCCCGTAATCGCATGCTGCCGCGAGATAGGATCACTGCTTTGCTCGAT
CCTGCTTCCTCCTTTCTTGAGCTTTCGCCTCTTGCCGGCTATGAGCTTTATCCCGAGGCCGACGTTCCCGCGGGG
GGCATCATCACCGGCCTCGGTCAGGTTGAGGGTGTTACCTGTGTCGTCGTCGCCAATGATAGTACCGTCAAGGGC
GGCTCTTATTATCCCATCACTGTCAAGAAACATTTACGCGCCCAGGCCGTCGCCCAAGAGAATAACCTTCCGTAG
GCCTCTTCCCATATCCCTACATCTCCCCCCCCCCCCCCAACCCCCTTCTCCTTTACACCTACTGAATCGTCTCCT
CCAGCTGCATCTACCTCGTCGACTCCGGCGGCGCCAACCTCCCTCATCAAGCCGACGTCTTCCCCGATCAGAACC
ATTTCGGTCGCATCTTCTACAACCAAGCCCGTATGTCCGCCCGCGGCATTCCCCAAATCTCCGTCGTCATGGGCC
CCTGCACCGCCGGTGGCGCCTACGTCCCCGCCATGAGCGACGAGGCCATCATCGTCCGGGACCAGGGCCACATCT
TCCTCGCAGGACCGCCCCTCGTCAAGGCCGCCACCGGAGAGGTCGTCTCCCCGGAGGACCTCGGCGGCGGTCTCA
TGCACTCATCCGTCTCCGGCGTCACCGATTATCTCGCCGCCGACGACGCCCACGCCCTCGTCCTCGCCCGTCGTT
GTGTCGCCAACCTCAACTGGCCCCCTTGCTCTGCTACGACCCCTATCCGAGAAGACGAACCCCCCTTATACGATC
CGGACGAACTCCTCGGCATCGCCTCTCCCAACCTCCGCAAGCCCCTCCCCATCCGCGACGTCATCGCTCGCATCG
TCGACGGCTCCCGCTTCTCCGAATTCAAAGCCTTATTCGGAACGACCCTCGTGACCGGCTTCGCCACCATACACG
GTCACCCCGTCGGCATCGTCGCCAACGACGGCATCCTCTTTGCCGCCTCCGCCGTCAAGGGCGCCCACTTCGTCC
AGCTCTGCGCCCAGCGCGGCCTTCCCCTCGTCTTCCTCCAGAACATTGCCGGCTTCATGGTCGGCGCTGCCGCCG
AGCGTGACGGCATCGCCAAGCACGGCGCCAAGTTCGTCACCGCCGTCGCTTGCGCCGACGTCCCCAAGTTCACCG
TCGTCGTCGGCGGATCGTACGGCGCCGGAAACTACGGCATGTGCGGTCGCGCCTACAGCCCGCGCTTCCTCTGGA
TGTGGCCAAACGCCCGCATCGGCGTCATGGGCGGCGAGCAGCTCGCCGCCGTCATGGAGACCGTCGGCCAAAAGG
CCGACCCGGAGCTCAAGGCCCGTATCGAGCGCGAGAGCGACGCCACCTACTCCTCCGCCCGCCTCTGGGTGAGTC
CCCCTTAGCCCTTGTGAGCCCCTGATAAGCCCCCCCGACGCCGGGCTGACCTCTTCCCAGGACGATGGCATCATC
CCGCCCCAACACACCCGCCGCTACCTTGCCCTGGGCCTCAGCGCCGCCATGGGAGGCCGCAACAAGGTCCAGCCC
AATGAGACACGCTACGGCGTCTTCCGCATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail