Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3638
Gene name
Locationscaffold_288:9948..14551
Strand-
Gene length (bp)4603
Transcript length (bp)4434
Coding sequence length (bp)4431
Protein length (aa) 1477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 2.0E-16 452 549
PF00168 C2 C2 domain 3.1E-13 594 699
PF00168 C2 C2 domain 2.0E-17 734 816
PF00168 C2 C2 domain 2.8E-22 1085 1186
PF00168 C2 C2 domain 3.9E-04 1334 1419

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 164 1260 0.0E+00
sp|Q03640|TCB3_YEAST Tricalbin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB3 PE=1 SV=1 156 1411 0.0E+00
sp|Q12466|TCB1_YEAST Tricalbin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB1 PE=1 SV=1 122 1258 3.0E-176
sp|P48231|TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB2 PE=1 SV=1 98 1274 1.0E-163
sp|O14065|YC31_SCHPO Uncharacterized protein C962.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC962.01 PE=2 SV=3 164 1421 2.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 164 1260 0.0E+00
sp|Q03640|TCB3_YEAST Tricalbin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB3 PE=1 SV=1 156 1411 0.0E+00
sp|Q12466|TCB1_YEAST Tricalbin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB1 PE=1 SV=1 122 1258 3.0E-176
sp|P48231|TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB2 PE=1 SV=1 98 1274 1.0E-163
sp|O14065|YC31_SCHPO Uncharacterized protein C962.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC962.01 PE=2 SV=3 164 1421 2.0E-129
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 233 713 3.0E-31
sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=1 SV=1 176 790 4.0E-28
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 176 790 6.0E-28
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 233 714 4.0E-27
sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 224 714 5.0E-27
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 232 715 9.0E-27
sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 PE=1 SV=1 176 790 9.0E-27
sp|Q5RAG2|ESYT1_PONAB Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 PE=2 SV=2 176 790 2.0E-26
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 232 718 2.0E-25
sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 213 687 2.0E-16
sp|Q93XX4|C2D61_ARATH C2 domain-containing protein At1g53590 OS=Arabidopsis thaliana GN=NTMC2T6.1 PE=1 SV=2 175 542 2.0E-15
sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 PE=1 SV=1 233 702 1.0E-14
sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 PE=1 SV=1 164 687 4.0E-14
sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=1 SV=1 1057 1223 5.0E-14
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 1084 1180 5.0E-13
sp|C9J798|RAS4B_HUMAN Ras GTPase-activating protein 4B OS=Homo sapiens GN=RASA4B PE=3 SV=2 1086 1205 1.0E-12
sp|O43374|RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sapiens GN=RASA4 PE=2 SV=2 1086 1205 1.0E-12
sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2 159 549 3.0E-12
sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus GN=Mctp2 PE=2 SV=1 1087 1188 2.0E-11
sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laevis GN=esyt2-b PE=2 SV=1 1085 1198 2.0E-11
sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laevis GN=esyt2-a PE=2 SV=1 1085 1198 3.0E-11
sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens GN=MCTP2 PE=1 SV=3 1087 1188 4.0E-11
sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 PE=1 SV=1 1085 1188 6.0E-11
sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 PE=1 SV=1 1085 1198 1.0E-10
sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus GN=Mctp2 PE=2 SV=1 1081 1180 1.0E-10
sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens GN=MCTP2 PE=1 SV=3 1081 1180 4.0E-10
sp|Q9BQG1|SYT3_HUMAN Synaptotagmin-3 OS=Homo sapiens GN=SYT3 PE=2 SV=1 1086 1181 5.0E-10
sp|P40748|SYT3_RAT Synaptotagmin-3 OS=Rattus norvegicus GN=Syt3 PE=1 SV=1 1086 1181 6.0E-10
sp|Q86SS6|SYT9_HUMAN Synaptotagmin-9 OS=Homo sapiens GN=SYT9 PE=2 SV=1 603 816 9.0E-10
sp|O35681|SYT3_MOUSE Synaptotagmin-3 OS=Mus musculus GN=Syt3 PE=1 SV=2 1087 1181 9.0E-10
sp|Q86KB1|ADCB_DICDI Arrestin domain-containing protein B OS=Dictyostelium discoideum GN=adcB PE=3 SV=1 1087 1204 1.0E-09
sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 1085 1198 2.0E-09
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 1085 1175 2.0E-09
sp|Q9R0N9|SYT9_MOUSE Synaptotagmin-9 OS=Mus musculus GN=Syt9 PE=1 SV=2 603 816 2.0E-09
sp|Q925C0|SYT9_RAT Synaptotagmin-9 OS=Rattus norvegicus GN=Syt9 PE=1 SV=1 603 816 2.0E-09
sp|P46097|SYT2_MOUSE Synaptotagmin-2 OS=Mus musculus GN=Syt2 PE=1 SV=1 1086 1189 7.0E-09
sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laevis GN=esyt2-b PE=2 SV=1 233 524 1.0E-08
sp|P41823|SY65_APLCA Synaptotagmin-1 OS=Aplysia californica GN=SYT1 PE=1 SV=2 1085 1176 1.0E-08
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 1075 1180 2.0E-08
sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laevis GN=esyt2-a PE=2 SV=1 233 524 2.0E-08
sp|Q8N9I0|SYT2_HUMAN Synaptotagmin-2 OS=Homo sapiens GN=SYT2 PE=1 SV=2 1086 1189 2.0E-08
sp|P29101|SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus GN=Syt2 PE=1 SV=1 1086 1189 2.0E-08
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 1078 1175 2.0E-08
sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2 1069 1198 3.0E-08
sp|P24507|SY63_DIPOM Synaptotagmin-C OS=Diplobatis ommata GN=P65-C PE=2 SV=1 1086 1170 3.0E-08
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 1067 1176 4.0E-08
sp|P24506|SY62_DIPOM Synaptotagmin-B OS=Diplobatis ommata GN=P65-B PE=1 SV=1 1086 1183 5.0E-08
sp|A0FGR9|ESYT3_HUMAN Extended synaptotagmin-3 OS=Homo sapiens GN=ESYT3 PE=1 SV=1 1069 1198 5.0E-08
sp|Q9S7J9|CAR9_ARATH Protein C2-DOMAIN ABA-RELATED 9 OS=Arabidopsis thaliana GN=CAR9 PE=2 SV=1 447 549 6.0E-08
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 1084 1202 8.0E-08
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 1078 1175 8.0E-08
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 1084 1202 9.0E-08
sp|Q9ZVT9|C2GR1_ARATH C2 and GRAM domain-containing protein At1g03370 OS=Arabidopsis thaliana GN=At1g03370 PE=2 SV=4 1086 1173 9.0E-08
sp|P40748|SYT3_RAT Synaptotagmin-3 OS=Rattus norvegicus GN=Syt3 PE=1 SV=1 591 816 1.0E-07
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 1078 1176 1.0E-07
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 1078 1176 1.0E-07
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 706 830 2.0E-07
sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=1 SV=1 452 712 2.0E-07
sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 1053 1174 2.0E-07
sp|Q14184|DOC2B_HUMAN Double C2-like domain-containing protein beta OS=Homo sapiens GN=DOC2B PE=1 SV=1 1029 1174 2.0E-07
sp|Q9Z268|RASL1_MOUSE RasGAP-activating-like protein 1 OS=Mus musculus GN=Rasal1 PE=1 SV=2 1087 1208 2.0E-07
sp|Q9BQG1|SYT3_HUMAN Synaptotagmin-3 OS=Homo sapiens GN=SYT3 PE=2 SV=1 591 816 3.0E-07
sp|A0A075F932|SYT1_ANSCY Synaptotagmin-1 OS=Anser cygnoid GN=SYT1 PE=2 SV=1 1086 1186 3.0E-07
sp|O95294|RASL1_HUMAN RasGAP-activating-like protein 1 OS=Homo sapiens GN=RASAL1 PE=1 SV=3 1087 1208 4.0E-07
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 1084 1177 5.0E-07
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 730 812 5.0E-07
sp|P47191|SYT1_CHICK Synaptotagmin-1 OS=Gallus gallus GN=SYT1 PE=2 SV=1 1085 1176 5.0E-07
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 1085 1207 6.0E-07
sp|O94812|BAIP3_HUMAN BAI1-associated protein 3 OS=Homo sapiens GN=BAIAP3 PE=1 SV=2 1086 1172 6.0E-07
sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD11 OS=Arabidopsis thaliana GN=AGD11 PE=2 SV=1 1084 1175 7.0E-07
sp|Q9FIK8|CAR11_ARATH Protein C2-DOMAIN ABA-RELATED 11 OS=Arabidopsis thaliana GN=CAR11 PE=1 SV=1 1084 1226 7.0E-07
sp|O35681|SYT3_MOUSE Synaptotagmin-3 OS=Mus musculus GN=Syt3 PE=1 SV=2 596 816 8.0E-07
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 1087 1187 9.0E-07
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 733 816 9.0E-07
sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 1069 1238 1.0E-06
sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=1 SV=1 1087 1175 1.0E-06
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 733 816 1.0E-06
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 733 816 1.0E-06
sp|Q80TT2|BAIP3_MOUSE BAI1-associated protein 3 OS=Mus musculus GN=Baiap3 PE=1 SV=3 1086 1175 1.0E-06
sp|P24505|SY61_DIPOM Synaptotagmin-A OS=Diplobatis ommata GN=P65-A PE=2 SV=1 1086 1176 1.0E-06
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 734 940 1.0E-06
sp|P21521|SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster GN=Syt1 PE=1 SV=3 1013 1182 1.0E-06
sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=1 SV=1 1050 1153 2.0E-06
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 1050 1153 2.0E-06
sp|P24507|SY63_DIPOM Synaptotagmin-C OS=Diplobatis ommata GN=P65-C PE=2 SV=1 597 812 2.0E-06
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 1086 1187 2.0E-06
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 1086 1187 2.0E-06
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 1086 1187 2.0E-06
sp|P70610|DOC2B_RAT Double C2-like domain-containing protein beta OS=Rattus norvegicus GN=Doc2b PE=1 SV=2 1029 1172 2.0E-06
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 1085 1202 3.0E-06
sp|P41885|RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans GN=rbf-1 PE=1 SV=2 596 816 3.0E-06
sp|P70169|DOC2B_MOUSE Double C2-like domain-containing protein beta OS=Mus musculus GN=Doc2b PE=1 SV=2 1029 1172 3.0E-06
sp|Q9LP65|CAR5_ARATH Protein C2-DOMAIN ABA-RELATED 5 OS=Arabidopsis thaliana GN=CAR5 PE=2 SV=1 1074 1194 3.0E-06
sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 1085 1176 4.0E-06
sp|P48018|SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus GN=SYT1 PE=1 SV=1 1085 1186 4.0E-06
sp|P46096|SYT1_MOUSE Synaptotagmin-1 OS=Mus musculus GN=Syt1 PE=1 SV=1 1085 1186 4.0E-06
sp|Q60HC0|SYT1_MACFA Synaptotagmin-1 OS=Macaca fascicularis GN=SYT1 PE=2 SV=1 1085 1186 4.0E-06
sp|P21579|SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens GN=SYT1 PE=1 SV=1 1085 1186 4.0E-06
sp|P21707|SYT1_RAT Synaptotagmin-1 OS=Rattus norvegicus GN=Syt1 PE=1 SV=3 1085 1186 4.0E-06
sp|Q9PU36|PCLO_CHICK Protein piccolo (Fragment) OS=Gallus gallus GN=PCLO PE=2 SV=1 1082 1175 6.0E-06
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 1037 1175 7.0E-06
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 1086 1187 7.0E-06
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 1086 1187 7.0E-06
sp|P34693|SYT1_CAEEL Synaptotagmin-1 OS=Caenorhabditis elegans GN=snt-1 PE=2 SV=1 1085 1176 8.0E-06
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 1086 1187 9.0E-06
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 1086 1187 9.0E-06
sp|Q5RAG2|ESYT1_PONAB Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 PE=2 SV=2 1087 1153 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 183 205 22
2 716 738 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3638
MSALEESELKAQGAIEAAEDPKSLVSADEAEREIVELSKNAGVAAFNFDPDASLAQKRAQARAAIPPELQQSRRE
KGAAIITDQDDGAGPDEDLPEPSKAGALDVATSADGKHLIDGADPFAAEEPFSRTGWSPQMGWPASSPMEGDSLL
DHATWVEGKLPDSLYGDWYHNAALIVFACLSSWLIAVLGGGLGWVSIIMAVCATYYRTSLRRVRRNFRDDVTREL
ALKKLETDNESLEWINSFLVKFWPIYQPVLAQTIINSVDQVLSSATPAFLDSLKLKTFTLGSKPPRMEHVKTYPK
TEDDIVMMDWKFSFTPNDTADMTARQVKNRINPKVVLEIRIGKAMISKGFDVIVEDMAFSGIMRLKIKLQIPFPH
VDRVEMCFLERPTIDYVCKPLGGDNLGFDINFIPGLETFILEQIHGNLAPMMYAPNVFPIEVAKMLAGTPVDQAV
GVLALTLHGAQGLKNTDNFGGTIDPYACISFSRRQELARTKTVDDNPNPRWNETHYLIVTSFNDTVDIQIFDKNE
FRKSKELGVASFHLEDFLDDHVYENERLEVISNGKARGIVSCDFRFFPVLEAEKLPDGKVEPPPPSNQGILRFTV
EQAKDLDGTKSLYGMLNPYAVMLLNGKTIHQTKKLKRTNNPIWDNGSKEILITDRKKAKLGVTIKDDRDLAADQE
LGKYQIRLDEILECMSQGKEWYQLSGAQTGRVKMMAQWRPVAISGVAGTGGYLTPIGVMRLHFMRATDLRNLEAF
GKSDPYVRVMLSGIDKARTVTFKNDLNPEWDEVLYVPIHSERDRLSLEVMDFEKVGKDRSLGAIELFACDYVHEA
ENGEYVVHDKKEVREDGLRLHGKGITKGTLTYTAAFYPCLNIADPDDDDDDGEEDKAADKDGEKATTDDKSAATS
KTAADAGASDGGADKDGDGDGPPRRSLSTRGGRSTQDDGPPKIRLTPEELLKHESGMLIFRMLEAELPENNSRLE
VWVDDMAYPSYVSSTAPSRSHKFDEIGDCVIRELDVSRLILKARKKGDDKDDTVAQLAGNTMETLKQCLNNPTML
KLKTEDGKEGWVKVSLKYIPIKMQLDPSESINNMGKLRVDILDGTDLPSADRNGKSDPYCRFEMNGNEVYKTKII
KKTLSPVWNECFEVSVPSRTAAEFMVNVYDYDFADKPDFLGAAVISLASLEPFKPLESQYRLDGKSGSVRIRMLF
RPDYVTRSVQGTSTFSSGPGRIVTGVAGAPIKGGVAVAGAVGHGVGRGASRLKRGIFGKKEGDETNGSMADEAEG
GGEDSELMMRRRSTNQQPEPATHHQPSPRHDSFSHGRTKSMTASSMHSMSPGGAGATGKATFTVVKASGYPASTD
LYVAVSQMAPKEKAVGKTKHFKSSSSEWVFDETFSVRCSSDAQFKIEVKVDRFLGSDDDLGEHVYFVDETGAASP
KELSVGGGVVTIKSSFQPSEEPAESPRSHNLRRSFLGKRDGRSSREATPNAL
Coding >Ophio5|3638
ATGTCCGCTTTGGAGGAGAGCGAGCTCAAGGCTCAGGGCGCCATCGAGGCTGCCGAGGACCCCAAGAGCCTGGTA
TCGGCCGATGAGGCCGAGAGGGAAATCGTCGAGTTGTCCAAGAATGCCGGCGTTGCCGCCTTCAACTTCGATCCA
GATGCCAGTTTGGCGCAGAAGCGGGCGCAAGCCCGGGCGGCCATCCCTCCAGAGCTCCAGCAAAGTCGACGCGAG
AAAGGCGCGGCCATCATCACCGATCAGGACGATGGCGCCGGCCCGGACGAGGATCTGCCCGAGCCGAGCAAGGCC
GGCGCTCTCGATGTAGCCACGAGCGCAGACGGAAAGCACCTCATCGATGGAGCCGACCCGTTTGCCGCTGAGGAG
CCCTTCTCTCGCACTGGCTGGTCTCCCCAGATGGGCTGGCCGGCCTCTAGCCCCATGGAGGGAGACAGCCTGCTC
GACCACGCCACATGGGTCGAGGGCAAGCTCCCGGACAGTCTCTACGGTGACTGGTATCACAACGCCGCCCTCATC
GTCTTCGCCTGCCTCTCGTCCTGGCTCATCGCCGTCCTCGGCGGAGGCCTGGGCTGGGTTTCCATCATCATGGCC
GTCTGCGCCACCTACTACCGAACCTCGCTCCGGCGCGTGCGGCGTAACTTCCGCGACGACGTCACCAGAGAGCTG
GCCCTGAAGAAGCTCGAGACGGACAACGAATCGCTCGAGTGGATCAACTCGTTCCTCGTCAAGTTCTGGCCCATC
TACCAGCCCGTCCTCGCCCAGACCATCATCAACTCGGTCGACCAGGTTCTCAGTTCCGCCACCCCGGCCTTCCTC
GACAGCCTGAAGCTCAAGACCTTCACCCTCGGCTCCAAGCCCCCCCGCATGGAGCACGTCAAGACGTACCCCAAG
ACCGAGGACGACATTGTCATGATGGACTGGAAGTTCAGCTTTACGCCCAACGATACGGCCGACATGACGGCCCGC
CAGGTCAAGAACAGGATCAACCCCAAGGTGGTGCTGGAGATTCGCATCGGCAAGGCCATGATCAGCAAGGGCTTC
GACGTCATCGTCGAGGACATGGCCTTTTCGGGCATCATGCGCCTGAAAATCAAGCTGCAGATCCCCTTCCCCCAC
GTTGACAGGGTCGAAATGTGCTTCCTCGAACGGCCGACCATCGACTACGTCTGCAAGCCCCTGGGCGGCGACAAC
CTCGGCTTCGACATCAACTTCATCCCGGGCCTGGAGACGTTTATTCTCGAACAGATCCACGGCAACCTCGCCCCC
ATGATGTACGCGCCAAACGTCTTCCCCATCGAGGTGGCCAAGATGCTGGCCGGCACTCCCGTCGACCAGGCCGTC
GGCGTGCTCGCCCTGACGCTCCACGGCGCCCAGGGCCTCAAGAACACGGACAACTTTGGCGGCACCATCGACCCG
TACGCCTGCATCAGCTTCAGCCGACGGCAGGAGCTGGCGAGGACCAAGACGGTCGACGACAACCCCAATCCGAGG
TGGAACGAGACGCACTACCTCATCGTCACCTCCTTCAACGACACCGTCGACATTCAGATCTTCGACAAGAATGAA
TTCCGCAAATCCAAGGAGCTGGGCGTGGCCTCGTTCCATCTCGAGGACTTCCTCGACGATCACGTGTACGAGAAC
GAACGTCTCGAGGTGATTTCCAACGGCAAGGCCCGCGGCATCGTCTCGTGCGACTTCCGCTTCTTCCCCGTTCTC
GAGGCGGAGAAGCTCCCCGACGGCAAGGTGGAACCGCCGCCGCCGTCCAACCAGGGCATCCTGCGATTCACCGTC
GAGCAGGCCAAGGATCTCGACGGCACCAAGAGCCTCTACGGCATGCTCAACCCCTACGCCGTCATGCTGCTCAAC
GGCAAGACGATTCACCAGACCAAGAAGCTCAAGCGCACCAACAACCCCATCTGGGACAACGGGTCCAAGGAGATT
CTCATCACGGACCGCAAAAAGGCCAAGCTCGGCGTCACCATCAAGGACGACCGCGACCTCGCAGCCGACCAGGAA
CTCGGCAAGTACCAAATCAGGCTCGACGAGATACTGGAATGCATGAGCCAAGGCAAGGAATGGTATCAGCTGTCG
GGTGCCCAGACGGGTCGCGTCAAGATGATGGCCCAGTGGAGGCCCGTCGCCATATCGGGCGTCGCCGGCACCGGA
GGCTACCTCACGCCCATCGGCGTCATGCGCCTACACTTTATGAGGGCCACCGACCTGCGGAACCTCGAGGCCTTT
GGCAAGTCGGATCCGTACGTCCGAGTCATGCTGTCGGGCATCGACAAGGCCCGGACCGTCACCTTCAAGAACGAC
CTCAACCCCGAGTGGGACGAGGTCCTCTACGTCCCCATCCACTCGGAGCGAGACAGGCTCAGCCTGGAGGTGATG
GATTTCGAAAAGGTGGGCAAGGACCGAAGCCTCGGCGCCATCGAGCTGTTCGCCTGCGACTACGTCCACGAGGCC
GAAAACGGCGAGTATGTCGTCCATGACAAGAAGGAAGTCCGCGAAGACGGCCTGCGCCTCCACGGTAAGGGCATT
ACCAAGGGGACCCTCACTTATACCGCCGCCTTTTACCCCTGTCTCAACATTGCCGATCCCGACGACGACGACGAC
GACGGGGAAGAGGACAAGGCGGCAGACAAGGACGGCGAGAAAGCGACGACGGACGACAAGAGCGCCGCCACGTCA
AAGACGGCTGCCGACGCCGGAGCCTCGGATGGCGGCGCGGACAAGGACGGCGACGGCGACGGCCCTCCGAGGCGC
TCGCTGTCCACGAGGGGGGGACGTTCGACGCAAGACGACGGACCGCCCAAGATCCGACTGACACCCGAGGAGCTC
CTCAAGCACGAGAGCGGAATGCTCATCTTCCGCATGCTGGAGGCCGAGTTGCCGGAAAATAACAGCCGGCTGGAG
GTATGGGTCGACGACATGGCTTATCCGTCGTATGTGTCTTCGACGGCGCCTTCGCGAAGCCACAAGTTTGACGAG
ATTGGCGACTGCGTCATCCGCGAACTGGACGTGTCCCGGTTGATCCTCAAGGCTCGGAAGAAGGGGGACGACAAG
GACGACACGGTGGCCCAGCTGGCCGGCAACACGATGGAGACGCTCAAGCAGTGTCTGAACAACCCGACGATGCTC
AAGCTCAAGACGGAGGACGGCAAGGAAGGCTGGGTCAAGGTCAGCCTCAAGTACATACCCATCAAGATGCAGCTG
GACCCGAGCGAGAGCATCAACAACATGGGAAAGCTCCGAGTCGATATTCTGGACGGCACCGACCTGCCGTCGGCG
GACCGCAACGGGAAGAGCGACCCTTACTGCAGGTTTGAGATGAACGGCAACGAGGTGTACAAGACCAAGATTATC
AAGAAGACGCTGTCGCCGGTGTGGAACGAGTGCTTCGAGGTCAGCGTGCCGTCGCGGACGGCGGCCGAGTTCATG
GTCAACGTCTACGACTACGATTTCGCCGACAAGCCCGACTTTCTCGGGGCGGCCGTCATCAGTCTGGCGTCGCTG
GAGCCCTTTAAGCCGCTGGAGTCTCAGTATCGGCTGGACGGCAAATCGGGCAGCGTACGGATCCGGATGCTCTTC
CGGCCGGACTACGTGACGCGATCGGTGCAAGGCACGTCTACCTTTTCCAGCGGCCCCGGCAGGATCGTTACTGGC
GTGGCCGGAGCGCCCATCAAGGGGGGCGTGGCCGTGGCCGGGGCGGTGGGACACGGAGTCGGGCGGGGAGCGTCG
AGGCTGAAGCGCGGCATCTTCGGCAAGAAGGAGGGCGACGAGACCAACGGATCGATGGCGGACGAGGCGGAAGGC
GGAGGTGAAGACAGCGAACTGATGATGCGGCGGCGGTCGACGAACCAGCAGCCCGAGCCCGCGACGCACCACCAG
CCGTCTCCGCGTCACGACTCATTCAGCCATGGGCGGACCAAGAGCATGACGGCGTCGTCGATGCACAGCATGAGC
CCGGGCGGTGCCGGGGCGACGGGAAAAGCGACGTTTACCGTCGTCAAGGCCTCTGGCTATCCGGCCTCGACCGAC
CTCTACGTTGCCGTCTCGCAGATGGCACCCAAGGAGAAGGCGGTGGGCAAGACGAAGCACTTCAAGTCTTCGTCT
TCGGAATGGGTTTTCGACGAGACGTTTAGCGTCCGATGCAGCTCGGACGCGCAGTTCAAGATCGAGGTCAAGGTC
GACCGCTTCCTGGGCAGCGACGACGACCTGGGCGAGCACGTCTACTTCGTCGACGAGACGGGCGCGGCCTCTCCC
AAGGAGCTCTCGGTCGGAGGGGGCGTCGTCACCATCAAGAGCAGCTTCCAGCCTTCGGAGGAGCCGGCCGAGTCG
CCGCGGTCCCATAACCTGCGCCGGAGCTTCTTGGGGAAGCGAGACGGGCGGTCCAGTAGGGAGGCGACGCCCAAT
GCTCTA
Transcript >Ophio5|3638
ATGTCCGCTTTGGAGGAGAGCGAGCTCAAGGCTCAGGGCGCCATCGAGGCTGCCGAGGACCCCAAGAGCCTGGTA
TCGGCCGATGAGGCCGAGAGGGAAATCGTCGAGTTGTCCAAGAATGCCGGCGTTGCCGCCTTCAACTTCGATCCA
GATGCCAGTTTGGCGCAGAAGCGGGCGCAAGCCCGGGCGGCCATCCCTCCAGAGCTCCAGCAAAGTCGACGCGAG
AAAGGCGCGGCCATCATCACCGATCAGGACGATGGCGCCGGCCCGGACGAGGATCTGCCCGAGCCGAGCAAGGCC
GGCGCTCTCGATGTAGCCACGAGCGCAGACGGAAAGCACCTCATCGATGGAGCCGACCCGTTTGCCGCTGAGGAG
CCCTTCTCTCGCACTGGCTGGTCTCCCCAGATGGGCTGGCCGGCCTCTAGCCCCATGGAGGGAGACAGCCTGCTC
GACCACGCCACATGGGTCGAGGGCAAGCTCCCGGACAGTCTCTACGGTGACTGGTATCACAACGCCGCCCTCATC
GTCTTCGCCTGCCTCTCGTCCTGGCTCATCGCCGTCCTCGGCGGAGGCCTGGGCTGGGTTTCCATCATCATGGCC
GTCTGCGCCACCTACTACCGAACCTCGCTCCGGCGCGTGCGGCGTAACTTCCGCGACGACGTCACCAGAGAGCTG
GCCCTGAAGAAGCTCGAGACGGACAACGAATCGCTCGAGTGGATCAACTCGTTCCTCGTCAAGTTCTGGCCCATC
TACCAGCCCGTCCTCGCCCAGACCATCATCAACTCGGTCGACCAGGTTCTCAGTTCCGCCACCCCGGCCTTCCTC
GACAGCCTGAAGCTCAAGACCTTCACCCTCGGCTCCAAGCCCCCCCGCATGGAGCACGTCAAGACGTACCCCAAG
ACCGAGGACGACATTGTCATGATGGACTGGAAGTTCAGCTTTACGCCCAACGATACGGCCGACATGACGGCCCGC
CAGGTCAAGAACAGGATCAACCCCAAGGTGGTGCTGGAGATTCGCATCGGCAAGGCCATGATCAGCAAGGGCTTC
GACGTCATCGTCGAGGACATGGCCTTTTCGGGCATCATGCGCCTGAAAATCAAGCTGCAGATCCCCTTCCCCCAC
GTTGACAGGGTCGAAATGTGCTTCCTCGAACGGCCGACCATCGACTACGTCTGCAAGCCCCTGGGCGGCGACAAC
CTCGGCTTCGACATCAACTTCATCCCGGGCCTGGAGACGTTTATTCTCGAACAGATCCACGGCAACCTCGCCCCC
ATGATGTACGCGCCAAACGTCTTCCCCATCGAGGTGGCCAAGATGCTGGCCGGCACTCCCGTCGACCAGGCCGTC
GGCGTGCTCGCCCTGACGCTCCACGGCGCCCAGGGCCTCAAGAACACGGACAACTTTGGCGGCACCATCGACCCG
TACGCCTGCATCAGCTTCAGCCGACGGCAGGAGCTGGCGAGGACCAAGACGGTCGACGACAACCCCAATCCGAGG
TGGAACGAGACGCACTACCTCATCGTCACCTCCTTCAACGACACCGTCGACATTCAGATCTTCGACAAGAATGAA
TTCCGCAAATCCAAGGAGCTGGGCGTGGCCTCGTTCCATCTCGAGGACTTCCTCGACGATCACGTGTACGAGAAC
GAACGTCTCGAGGTGATTTCCAACGGCAAGGCCCGCGGCATCGTCTCGTGCGACTTCCGCTTCTTCCCCGTTCTC
GAGGCGGAGAAGCTCCCCGACGGCAAGGTGGAACCGCCGCCGCCGTCCAACCAGGGCATCCTGCGATTCACCGTC
GAGCAGGCCAAGGATCTCGACGGCACCAAGAGCCTCTACGGCATGCTCAACCCCTACGCCGTCATGCTGCTCAAC
GGCAAGACGATTCACCAGACCAAGAAGCTCAAGCGCACCAACAACCCCATCTGGGACAACGGGTCCAAGGAGATT
CTCATCACGGACCGCAAAAAGGCCAAGCTCGGCGTCACCATCAAGGACGACCGCGACCTCGCAGCCGACCAGGAA
CTCGGCAAGTACCAAATCAGGCTCGACGAGATACTGGAATGCATGAGCCAAGGCAAGGAATGGTATCAGCTGTCG
GGTGCCCAGACGGGTCGCGTCAAGATGATGGCCCAGTGGAGGCCCGTCGCCATATCGGGCGTCGCCGGCACCGGA
GGCTACCTCACGCCCATCGGCGTCATGCGCCTACACTTTATGAGGGCCACCGACCTGCGGAACCTCGAGGCCTTT
GGCAAGTCGGATCCGTACGTCCGAGTCATGCTGTCGGGCATCGACAAGGCCCGGACCGTCACCTTCAAGAACGAC
CTCAACCCCGAGTGGGACGAGGTCCTCTACGTCCCCATCCACTCGGAGCGAGACAGGCTCAGCCTGGAGGTGATG
GATTTCGAAAAGGTGGGCAAGGACCGAAGCCTCGGCGCCATCGAGCTGTTCGCCTGCGACTACGTCCACGAGGCC
GAAAACGGCGAGTATGTCGTCCATGACAAGAAGGAAGTCCGCGAAGACGGCCTGCGCCTCCACGGTAAGGGCATT
ACCAAGGGGACCCTCACTTATACCGCCGCCTTTTACCCCTGTCTCAACATTGCCGATCCCGACGACGACGACGAC
GACGGGGAAGAGGACAAGGCGGCAGACAAGGACGGCGAGAAAGCGACGACGGACGACAAGAGCGCCGCCACGTCA
AAGACGGCTGCCGACGCCGGAGCCTCGGATGGCGGCGCGGACAAGGACGGCGACGGCGACGGCCCTCCGAGGCGC
TCGCTGTCCACGAGGGGGGGACGTTCGACGCAAGACGACGGACCGCCCAAGATCCGACTGACACCCGAGGAGCTC
CTCAAGCACGAGAGCGGAATGCTCATCTTCCGCATGCTGGAGGCCGAGTTGCCGGAAAATAACAGCCGGCTGGAG
GTATGGGTCGACGACATGGCTTATCCGTCGTATGTGTCTTCGACGGCGCCTTCGCGAAGCCACAAGTTTGACGAG
ATTGGCGACTGCGTCATCCGCGAACTGGACGTGTCCCGGTTGATCCTCAAGGCTCGGAAGAAGGGGGACGACAAG
GACGACACGGTGGCCCAGCTGGCCGGCAACACGATGGAGACGCTCAAGCAGTGTCTGAACAACCCGACGATGCTC
AAGCTCAAGACGGAGGACGGCAAGGAAGGCTGGGTCAAGGTCAGCCTCAAGTACATACCCATCAAGATGCAGCTG
GACCCGAGCGAGAGCATCAACAACATGGGAAAGCTCCGAGTCGATATTCTGGACGGCACCGACCTGCCGTCGGCG
GACCGCAACGGGAAGAGCGACCCTTACTGCAGGTTTGAGATGAACGGCAACGAGGTGTACAAGACCAAGATTATC
AAGAAGACGCTGTCGCCGGTGTGGAACGAGTGCTTCGAGGTCAGCGTGCCGTCGCGGACGGCGGCCGAGTTCATG
GTCAACGTCTACGACTACGATTTCGCCGACAAGCCCGACTTTCTCGGGGCGGCCGTCATCAGTCTGGCGTCGCTG
GAGCCCTTTAAGCCGCTGGAGTCTCAGTATCGGCTGGACGGCAAATCGGGCAGCGTACGGATCCGGATGCTCTTC
CGGCCGGACTACGTGACGCGATCGGTGCAAGGCACGTCTACCTTTTCCAGCGGCCCCGGCAGGATCGTTACTGGC
GTGGCCGGAGCGCCCATCAAGGGGGGCGTGGCCGTGGCCGGGGCGGTGGGACACGGAGTCGGGCGGGGAGCGTCG
AGGCTGAAGCGCGGCATCTTCGGCAAGAAGGAGGGCGACGAGACCAACGGATCGATGGCGGACGAGGCGGAAGGC
GGAGGTGAAGACAGCGAACTGATGATGCGGCGGCGGTCGACGAACCAGCAGCCCGAGCCCGCGACGCACCACCAG
CCGTCTCCGCGTCACGACTCATTCAGCCATGGGCGGACCAAGAGCATGACGGCGTCGTCGATGCACAGCATGAGC
CCGGGCGGTGCCGGGGCGACGGGAAAAGCGACGTTTACCGTCGTCAAGGCCTCTGGCTATCCGGCCTCGACCGAC
CTCTACGTTGCCGTCTCGCAGATGGCACCCAAGGAGAAGGCGGTGGGCAAGACGAAGCACTTCAAGTCTTCGTCT
TCGGAATGGGTTTTCGACGAGACGTTTAGCGTCCGATGCAGCTCGGACGCGCAGTTCAAGATCGAGGTCAAGGTC
GACCGCTTCCTGGGCAGCGACGACGACCTGGGCGAGCACGTCTACTTCGTCGACGAGACGGGCGCGGCCTCTCCC
AAGGAGCTCTCGGTCGGAGGGGGCGTCGTCACCATCAAGAGCAGCTTCCAGCCTTCGGAGGAGCCGGCCGAGTCG
CCGCGGTCCCATAACCTGCGCCGGAGCTTCTTGGGGAAGCGAGACGGGCGGTCCAGTAGGGAGGCGACGCCCAAT
GCTCTATAG
Gene >Ophio5|3638
ATGTCCGCTTTGGAGGAGAGCGAGCTCAAGGCTCAGGGCGCCATCGAGGCTGCCGAGGACCCCAAGAGCCTGGTA
TCGGCCGATGAGGCCGAGAGGGAAATCGTCGAGTTGTCCAAGAATGCCGGCGTTGCCGCCTTCAACTTCGATCCA
GATGCCAGTTTGGCGCAGAAGCGGGCGCAAGCCCGGGCGGTACGTCGCATCTCTTGCCGCTCTACCATTCGTCTG
CTCAACTCTGACCTGTCCTCTCCTTCCAGGCCATCCCTCCAGAGCTCCAGCAAAGTCGACGCGAGAAAGGCGCGG
CCATCATCACCGATCAGGACGATGGCGCCGGCCCGGACGAGGATCTGCCCGAGCCGAGCAAGGCCGGCGCTCTCG
ATGTAGCCACGAGCGCAGACGGAAAGCACCTCATCGATGGAGCCGACCCGTTTGCCGCTGAGGAGCCCTTCTCTC
GCACTGGCTGGTCTCCCCAGATGGGCTGGCCGGCCTCTAGCCCCATGGAGGGAGACAGCCTGCTCGACCACGCCA
CATGGGTCGAGGGCAAGCTCCCGGACAGTCTCTACGGTGGTGAGTACCAACGGACGTGTGCCGACCTGCACGCGC
TGACCCTCTCTAGACTGGTATCACAACGCCGCCCTCATCGTCTTCGCCTGCCTCTCGTCCTGGCTCATCGCCGTC
CTCGGCGGAGGCCTGGGCTGGGTTTCCATCATCATGGCCGTCTGCGCCACCTACTACCGAACCTCGCTCCGGCGC
GTGCGGCGTAACTTCCGCGACGACGTCACCAGAGAGCTGGCCCTGAAGAAGCTCGAGACGGACAACGAATCGCTC
GAGTGGATCAACTCGTTCCTCGTCAAGTTCTGGCCCATCTACCAGCCCGTCCTCGCCCAGACCATCATCAACTCG
GTCGACCAGGTTCTCAGTTCCGCCACCCCGGCCTTCCTCGACAGCCTGAAGCTCAAGACCTTCACCCTCGGCTCC
AAGCCCCCCCGCATGGAGCACGTCAAGACGTACCCCAAGACCGAGGACGACATTGTCATGATGGACTGGAAGTTC
AGCTTTACGCCCAACGATACGGCCGACATGACGGCCCGCCAGGTCAAGAACAGGATCAACCCCAAGGTGGTGCTG
GAGATTCGCATCGGCAAGGCCATGATCAGCAAGGGCTTCGACGTCATCGTCGAGGACATGGCCTTTTCGGGCATC
ATGCGCCTGAAAATCAAGCTGCAGATCCCCTTCCCCCACGTTGACAGGGTCGAAATGTGCTTCCTCGAACGGCCG
ACCATCGACTACGTCTGCAAGCCCCTGGGCGGCGACAACCTCGGCTTCGACATCAACTTCATCCCGGGCCTGGAG
ACGTTTATTCTCGAACAGATCCACGGCAACCTCGCCCCCATGATGTACGCGCCAAACGTCTTCCCCATCGAGGTG
GCCAAGATGCTGGCCGGCACTCCCGTCGACCAGGCCGTCGGCGTGCTCGCCCTGACGCTCCACGGCGCCCAGGGC
CTCAAGAACACGGACAACTTTGGCGGCACCATCGACCCGTACGCCTGCATCAGCTTCAGCCGACGGCAGGAGCTG
GCGAGGACCAAGACGGTCGACGACAACCCCAATCCGAGGTGGAACGAGACGCACTACCTCATCGTCACCTCCTTC
AACGACACCGTCGACATTCAGATCTTCGACAAGAATGAATTCCGCAAATCCAAGGAGCTGGGCGTGGCCTCGTTC
CATCTCGAGGACTTCCTCGACGATCACGTGTACGAGAACGAACGTCTCGAGGTGATTTCCAACGGCAAGGCCCGC
GGCATCGTCTCGTGCGACTTCCGCTTCTTCCCCGTTCTCGAGGCGGAGAAGCTCCCCGACGGCAAGGTGGAACCG
CCGCCGCCGTCCAACCAGGGCATCCTGCGATTCACCGTCGAGCAGGCCAAGGATCTCGACGGCACCAAGAGCCTC
TACGGCATGCTCAACCCCTACGCCGTCATGCTGCTCAACGGCAAGACGATTCACCAGACCAAGAAGCTCAAGCGC
ACCAACAACCCCATCTGGGACAACGGGTCCAAGGAGATTCTCATCACGGACCGCAAAAAGGCCAAGCTCGGCGTC
ACCATCAAGGACGACCGCGACCTCGCAGCCGACCAGGAACTCGGCAAGTACCAAATCAGGCTCGACGAGATACTG
GAATGCATGAGCCAAGGCAAGGAATGGTATCAGCTGTCGGGTGCCCAGACGGGTCGCGTCAAGATGATGGCCCAG
TGGAGGCCCGTCGCCATATCGGGCGTCGCCGGCACCGGAGGCTACCTCACGCCCATCGGCGTCATGCGCCTACAC
TTTATGAGGGCCACCGACCTGCGGAACCTCGAGGCCTTTGGCAAGTCGGATCCGTACGTCCGAGTCATGCTGTCG
GGCATCGACAAGGCCCGGACCGTCACCTTCAAGAACGACCTCAACCCCGAGTGGGACGAGGTCCTCTACGTCCCC
ATCCACTCGGAGCGAGACAGGCTCAGCCTGGAGGTGATGGATTTCGAAAAGGTGGGCAAGGACCGAAGCCTCGGC
GCCATCGAGCTGTTCGCCTGCGACTACGTCCACGAGGCCGAAAACGGCGAGTATGTCGTCCATGACAAGAAGGAA
GTCCGCGAAGACGGCCTGCGCCTCCACGGTAAGGGCATTACCAAGGGGACCCTCACTTATACCGCCGCCTTTTAC
CCCTGTCTCAACATTGCCGATCCCGACGACGACGACGACGACGGGGAAGAGGACAAGGCGGCAGACAAGGACGGC
GAGAAAGCGACGACGGACGACAAGAGCGCCGCCACGTCAAAGACGGCTGCCGACGCCGGAGCCTCGGATGGCGGC
GCGGACAAGGACGGCGACGGCGACGGCCCTCCGAGGCGCTCGCTGTCCACGAGGGGGGGACGTTCGACGCAAGAC
GACGGACCGCCCAAGATCCGACTGACACCCGAGGAGCTCCTCAAGCACGAGAGCGGAATGCTCATCTTCCGCATG
CTGGAGGCCGAGTTGCCGGAAAATAACAGCCGGCTGGAGGTATGGGTCGACGACATGGCTTATCCGTCGTATGTG
TCTTCGACGGCGCCTTCGCGAAGCCACAAGTTTGACGAGATTGGCGACTGCGTCATCCGCGAACTGGACGTGTCC
CGGTTGATCCTCAAGGCTCGGAAGAAGGGGGACGACAAGGACGACACGGTGGCCCAGCTGGCCGGCAACACGATG
GAGACGCTCAAGCAGTGTCTGGTGAGTTGTGCCCGGACGCGGATGTCGACATGGCTGACTCGGAGACGCCTGGTA
GAACAACCCGACGATGCTCAAGCTCAAGACGGAGGACGGCAAGGAAGGCTGGGTCAAGGTCAGCCTCAAGTACAT
ACCCATCAAGATGCAGCTGGACCCGAGCGAGAGCATCAACAACATGGGAAAGCTCCGAGTCGATATTCTGGACGG
CACCGACCTGCCGTCGGCGGACCGCAACGGGAAGAGCGACCCTTACTGCAGGTTTGAGATGAACGGCAACGAGGT
GTACAAGACCAAGATTATCAAGAAGACGCTGTCGCCGGTGTGGAACGAGTGCTTCGAGGTCAGCGTGCCGTCGCG
GACGGCGGCCGAGTTCATGGTCAACGTCTACGACTACGATTTCGCCGACAAGCCCGACTTTCTCGGGGCGGCCGT
CATCAGTCTGGCGTCGCTGGAGCCCTTTAAGCCGCTGGAGTCTCAGTATCGGCTGGACGGCAAATCGGGCAGCGT
ACGGATCCGGATGCTCTTCCGGCCGGACTACGTGACGCGATCGGTGCAAGGCACGTCTACCTTTTCCAGCGGCCC
CGGCAGGATCGTTACTGGCGTGGCCGGAGCGCCCATCAAGGGGGGCGTGGCCGTGGCCGGGGCGGTGGGACACGG
AGTCGGGCGGGGAGCGTCGAGGCTGAAGCGCGGCATCTTCGGCAAGAAGGAGGGCGACGAGACCAACGGATCGAT
GGCGGACGAGGCGGAAGGCGGAGGTGAAGACAGCGAACTGATGATGCGGCGGCGGTCGACGAACCAGCAGCCCGA
GCCCGCGACGCACCACCAGCCGTCTCCGCGTCACGACTCATTCAGCCATGGGCGGACCAAGAGCATGACGGCGTC
GTCGATGCACAGCATGAGCCCGGGCGGTGCCGGGGCGACGGGAAAAGCGACGTTTACCGTCGTCAAGGCCTCTGG
CTATCCGGCCTCGACCGACCTCTACGTTGCCGTCTCGCAGATGGCACCCAAGGAGAAGGCGGTGGGCAAGACGAA
GCACTTCAAGTCTTCGTCTTCGGAATGGGTTTTCGACGAGACGTTTAGCGTCCGATGCAGCTCGGACGCGCAGTT
CAAGATCGAGGTCAAGGTCGACCGCTTCCTGGGCAGCGACGACGACCTGGGCGAGCACGTCTACTTCGTCGACGA
GACGGGCGCGGCCTCTCCCAAGGAGCTCTCGGTCGGAGGGGGCGTCGTCACCATCAAGAGCAGCTTCCAGCCTTC
GGAGGAGCCGGCCGAGTCGCCGCGGTCCCATAACCTGCGCCGGAGCTTCTTGGGGAAGCGAGACGGGCGGTCCAG
TAGGGAGGCGACGCCCAATGCTCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail