Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3624
Gene name
Locationscaffold_286:18070..18883
Strand+
Gene length (bp)813
Transcript length (bp)813
Coding sequence length (bp)810
Protein length (aa) 270

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09791 Oxidored-like Oxidoreductase-like protein, N-terminal 2.6E-23 160 204

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q02873|YP107_YEAST UPF0651 protein YPL107W, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL107W PE=1 SV=1 126 208 3.0E-17
sp|Q9USH2|YJH2_SCHPO UPF0651 protein P31B10.02, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCP31B10.02 PE=3 SV=1 158 266 6.0E-10

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1331 0.1495 0.0338 0.1715 0.8518 0.0077 0.0716 0.0293 0.0361 0.0097

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2492
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7513
Ophiocordyceps australis map64 (Brazil) OphauB2|6959
Ophiocordyceps camponoti-floridani Ophcf2|01114
Ophiocordyceps camponoti-rufipedis Ophun1|7193
Ophiocordyceps kimflemingae Ophio5|3624 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3604

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3624
MSVPTRTGSQALRFLLPRRAAPRLPIRRFASAAAAAAEWPQRCPLGPYYDIILDNPTQYAPEKRKQSPSAPPRGT
QSESRPEKKPDPQPSAPPPPEKKQEPRPSAPPARKKKPGRKPTATSSSAPSTTPTERARIVFGSRLLGPAEEADR
LAAKRARSTTMAGVVVPPRPEEPDNCCMSGCVDCVWERYREEMEEWSAKKNEAQMRLADGAGTVDADGGGSDAKL
DPRLRSAKMARNLWDEEAFANVPVGIREFMKHEKRLREGRQEGAA
Coding >Ophio5|3624
ATGTCGGTGCCCACGAGAACAGGCTCGCAAGCGTTGCGCTTCCTCCTCCCCCGACGCGCGGCGCCTCGCCTCCCT
ATACGACGCTTCGCTTCCGCCGCCGCCGCCGCCGCCGAGTGGCCACAGAGGTGCCCGCTAGGCCCGTACTACGAC
ATCATCCTTGACAACCCGACGCAGTACGCGCCCGAGAAAAGGAAGCAGTCGCCCTCGGCGCCCCCTCGCGGAACC
CAGTCCGAGTCTCGGCCGGAGAAGAAACCCGATCCACAACCGTCCGCTCCGCCGCCGCCGGAGAAGAAACAAGAG
CCGAGACCGTCCGCTCCGCCGGCCCGGAAGAAGAAGCCCGGGCGCAAGCCCACAGCCACGTCATCGTCGGCGCCG
TCGACCACGCCGACCGAGCGCGCCCGCATCGTCTTCGGGTCCCGACTCTTAGGGCCCGCCGAGGAGGCTGACCGG
CTCGCAGCCAAGCGGGCACGATCGACTACGATGGCCGGCGTTGTCGTGCCTCCGCGTCCCGAAGAGCCGGACAAC
TGCTGCATGAGCGGGTGCGTCGACTGTGTGTGGGAGCGGTATCGGGAGGAGATGGAGGAGTGGTCGGCCAAGAAA
AACGAGGCGCAGATGCGCCTCGCTGATGGCGCCGGCACCGTAGATGCCGATGGTGGCGGCTCCGACGCTAAATTG
GACCCCAGGCTCCGAAGTGCTAAGATGGCGAGGAACCTCTGGGACGAAGAGGCGTTTGCGAATGTACCGGTCGGC
ATTCGAGAGTTTATGAAGCATGAAAAACGGTTGAGAGAGGGTCGCCAAGAAGGCGCCGCG
Transcript >Ophio5|3624
ATGTCGGTGCCCACGAGAACAGGCTCGCAAGCGTTGCGCTTCCTCCTCCCCCGACGCGCGGCGCCTCGCCTCCCT
ATACGACGCTTCGCTTCCGCCGCCGCCGCCGCCGCCGAGTGGCCACAGAGGTGCCCGCTAGGCCCGTACTACGAC
ATCATCCTTGACAACCCGACGCAGTACGCGCCCGAGAAAAGGAAGCAGTCGCCCTCGGCGCCCCCTCGCGGAACC
CAGTCCGAGTCTCGGCCGGAGAAGAAACCCGATCCACAACCGTCCGCTCCGCCGCCGCCGGAGAAGAAACAAGAG
CCGAGACCGTCCGCTCCGCCGGCCCGGAAGAAGAAGCCCGGGCGCAAGCCCACAGCCACGTCATCGTCGGCGCCG
TCGACCACGCCGACCGAGCGCGCCCGCATCGTCTTCGGGTCCCGACTCTTAGGGCCCGCCGAGGAGGCTGACCGG
CTCGCAGCCAAGCGGGCACGATCGACTACGATGGCCGGCGTTGTCGTGCCTCCGCGTCCCGAAGAGCCGGACAAC
TGCTGCATGAGCGGGTGCGTCGACTGTGTGTGGGAGCGGTATCGGGAGGAGATGGAGGAGTGGTCGGCCAAGAAA
AACGAGGCGCAGATGCGCCTCGCTGATGGCGCCGGCACCGTAGATGCCGATGGTGGCGGCTCCGACGCTAAATTG
GACCCCAGGCTCCGAAGTGCTAAGATGGCGAGGAACCTCTGGGACGAAGAGGCGTTTGCGAATGTACCGGTCGGC
ATTCGAGAGTTTATGAAGCATGAAAAACGGTTGAGAGAGGGTCGCCAAGAAGGCGCCGCGTGA
Gene >Ophio5|3624
ATGTCGGTGCCCACGAGAACAGGCTCGCAAGCGTTGCGCTTCCTCCTCCCCCGACGCGCGGCGCCTCGCCTCCCT
ATACGACGCTTCGCTTCCGCCGCCGCCGCCGCCGCCGAGTGGCCACAGAGGTGCCCGCTAGGCCCGTACTACGAC
ATCATCCTTGACAACCCGACGCAGTACGCGCCCGAGAAAAGGAAGCAGTCGCCCTCGGCGCCCCCTCGCGGAACC
CAGTCCGAGTCTCGGCCGGAGAAGAAACCCGATCCACAACCGTCCGCTCCGCCGCCGCCGGAGAAGAAACAAGAG
CCGAGACCGTCCGCTCCGCCGGCCCGGAAGAAGAAGCCCGGGCGCAAGCCCACAGCCACGTCATCGTCGGCGCCG
TCGACCACGCCGACCGAGCGCGCCCGCATCGTCTTCGGGTCCCGACTCTTAGGGCCCGCCGAGGAGGCTGACCGG
CTCGCAGCCAAGCGGGCACGATCGACTACGATGGCCGGCGTTGTCGTGCCTCCGCGTCCCGAAGAGCCGGACAAC
TGCTGCATGAGCGGGTGCGTCGACTGTGTGTGGGAGCGGTATCGGGAGGAGATGGAGGAGTGGTCGGCCAAGAAA
AACGAGGCGCAGATGCGCCTCGCTGATGGCGCCGGCACCGTAGATGCCGATGGTGGCGGCTCCGACGCTAAATTG
GACCCCAGGCTCCGAAGTGCTAAGATGGCGAGGAACCTCTGGGACGAAGAGGCGTTTGCGAATGTACCGGTCGGC
ATTCGAGAGTTTATGAAGCATGAAAAACGGTTGAGAGAGGGTCGCCAAGAAGGCGCCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail